IED ID | IndEnz0002014249 |
Enzyme Type ID | protease014249 |
Protein Name |
Deubiquitinase and deneddylase Dub2 ChlaDub2 EC 3.4.22.- |
Gene Name | cdu2 CT_867 |
Organism | Chlamydia trachomatis (strain D/UW-3/Cx) |
Taxonomic Lineage | cellular organisms Bacteria PVC group Chlamydiae Chlamydiia Chlamydiales Chlamydiaceae Chlamydia/Chlamydophila group Chlamydia Chlamydia trachomatis Chlamydia trachomatis (strain D/UW-3/Cx) |
Enzyme Sequence | MEPIHNPPPQTCSYSRPSTTYTSFKDASCGTKVTRIIIALFLIVISCGLILCAYTFRDLLDADYSAQEGPQQATKLLQQLDKVLTGPPLPIWDNEHLFQFSCLMQNKHRRVLPIDICNPLTKFNFLEYICNCLMTKQSVNVNETDMCELFCPPTCTPENYRRLLCTSSVFPFVMWHDPSADTQEAMLTKMDQTMSSGRVGNSHWVLVIVDIEHRCVTFFDSFYDYIASPQQMREQLEGLAASLGAIYPKEGGADSDQEELLSPFQVRIGSTVKVQSPGEFTCGAWCCQFLAWYLENPDFDLEEKVPTNPSERRALLADFISTTEQAMSRYSSLSWPTTD |
Enzyme Length | 339 |
Uniprot Accession Number | O84875 |
Absorption | |
Active Site | ACT_SITE 203; /evidence=ECO:0000255; ACT_SITE 220; /evidence=ECO:0000255; ACT_SITE 282; /evidence=ECO:0000255 |
Activity Regulation | |
Binding Site | |
Calcium Binding | |
catalytic Activity | |
DNA Binding | |
EC Number | 3.4.22.- |
Enzyme Function | FUNCTION: Effector proteins function to alter host cell physiology and promote bacterial survival in host tissues. This protease possesses deubiquitinating and deneddylating activities. {ECO:0000269|PubMed:16824101}. |
Temperature Dependency | |
PH Dependency | |
Pathway | |
nucleotide Binding | |
Features | Active site (3); Chain (1); Transmembrane (1) |
Keywords | Hydrolase;Membrane;Protease;Reference proteome;Secreted;Thiol protease;Transmembrane;Transmembrane helix;Ubl conjugation pathway;Virulence |
Interact With | |
Induction | |
Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000250}. Host cell {ECO:0000250}. Membrane {ECO:0000250}; Single-pass membrane protein {ECO:0000250}. Note=Secreted, and delivered into the host cell. {ECO:0000250}. |
Modified Residue | |
Post Translational Modification | |
Signal Peptide | |
Structure 3D | |
Cross Reference PDB | - |
Mapped Pubmed ID | - |
Motif | |
Gene Encoded By | |
Mass | 38,411 |
Kinetics | |
Metal Binding | |
Rhea ID | |
Cross Reference Brenda |