| IED ID | IndEnz0002014266 |
| Enzyme Type ID | protease014266 |
| Protein Name |
Complement factor D EC 3.4.21.46 28 kDa adipocyte protein Adipsin C3 convertase activator Properdin factor D |
| Gene Name | Cfd Adn Df |
| Organism | Mus musculus (Mouse) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Glires (Rodents and rabbits) Rodentia Myomorpha (mice and others) Muroidea Muridae Murinae Mus Mus Mus musculus (Mouse) |
| Enzyme Sequence | MHSSVYFVALVILGAAVCAAQPRGRILGGQEAAAHARPYMASVQVNGTHVCGGTLLDEQWVLSAAHCMDGVTDDDSVQVLLGAHSLSAPEPYKRWYDVQSVVPHPGSRPDSLEDDLILFKLSQNASLGPHVRPLPLQYEDKEVEPGTLCDVAGWGVVTHAGRRPDVLHQLRVSIMNRTTCNLRTYHDGVVTINMMCAESNRRDTCRGDSGSPLVCGDAVEGVVTWGSRVCGNGKKPGVYTRVSSYRMWIENITNGNMTS |
| Enzyme Length | 259 |
| Uniprot Accession Number | P03953 |
| Absorption | |
| Active Site | ACT_SITE 66; /note=Charge relay system; ACT_SITE 115; /note=Charge relay system; ACT_SITE 209; /note=Charge relay system |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Selective cleavage of Arg-|-Lys bond in complement factor B when in complex with complement subcomponent C3b or with cobra venom factor.; EC=3.4.21.46; |
| DNA Binding | |
| EC Number | 3.4.21.46 |
| Enzyme Function | FUNCTION: Factor D cleaves factor B when the latter is complexed with factor C3b, activating the C3bbb complex, which then becomes the C3 convertase of the alternate pathway. Its function is homologous to that of C1s in the classical pathway. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (3); Alternative sequence (1); Beta strand (14); Chain (1); Disulfide bond (4); Domain (1); Glycosylation (5); Helix (4); Propeptide (1); Signal peptide (1); Turn (1) |
| Keywords | 3D-structure;Alternative splicing;Complement alternate pathway;Disulfide bond;Glycoprotein;Hydrolase;Immunity;Innate immunity;Protease;Reference proteome;Secreted;Serine protease;Signal;Zymogen |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted. |
| Modified Residue | |
| Post Translational Modification | PTM: N-glycosylated. {ECO:0000269|PubMed:16944957, ECO:0000269|PubMed:17330941}. |
| Signal Peptide | SIGNAL 1..20; /evidence=ECO:0000255 |
| Structure 3D | X-ray crystallography (1) |
| Cross Reference PDB | 5FCR; |
| Mapped Pubmed ID | 10725249; 10769753; 10982846; 10984455; 11130978; 11724962; 12401879; 12547703; 12558660; 12949072; 1374388; 15585877; 15883171; 15972690; 16141072; 16651386; 16951374; 17179051; 17410102; 17962484; 18068164; 18160458; 18188184; 19112490; 20038603; 20581430; 20709903; 20870940; 21263075; 21351141; 21378161; 21688269; 21704012; 21943708; 23012479; 23650618; 24036114; 24995977; 2506639; 25467802; 27564415; 27707997; 27775713; 28049691; 28057640; 28539427; 29531168; 31167128; 32012117; 32079203; 32376801; 3299705; 3299706; 33067533; 33135458; 34155972; 6411703; 7530249; 7592907; 7782070; 8043949; 8075499; 8996238; |
| Motif | |
| Gene Encoded By | |
| Mass | 28,057 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda | 3.4.21.46; |