| IED ID | IndEnz0002014280 |
| Enzyme Type ID | protease014280 |
| Protein Name |
HTH-type transcriptional regulator DegA Degradation activator |
| Gene Name | degA BSU10840 |
| Organism | Bacillus subtilis (strain 168) |
| Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Firmicutes Bacilli Bacillales Bacillaceae Bacillus Bacillus subtilis group Bacillus subtilis Bacillus subtilis subsp. subtilis Bacillus subtilis (strain 168) |
| Enzyme Sequence | MKTTIYDVAKAAGVSITTVSRVINNTGRISDKTRQKVMNVMNEMAYTPNVHAAALTGKRTNMIALVAPDISNPFYGELAKSIEERADELGFQMLICSTDYDPKKETKYFSVLKQKKVDGIIFATGIESHDSMSALEEIASEQIPIAMISQDKPLLPMDIVVIDDVRGGYEAAKHLLSLGHTNIACIIGDGSTTGEKNRIKGFRQAMEEAGVPIDESLIIQTRFSLESGKEEAGKLLDRNAPTAIFAFNDVLACAAIQAARIRGIKVPDDLSIIGFDNTILAEMAAPPLTTVAQPIKEMGAERHRTAGRSNRGKRKAKQKIVLPPELVVRHSTSPLNT |
| Enzyme Length | 337 |
| Uniprot Accession Number | P37947 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | DNA_BIND 5..24; /note=H-T-H motif; /evidence=ECO:0000255|PROSITE-ProRule:PRU00111 |
| EC Number | |
| Enzyme Function | FUNCTION: Involved in the control of degradation of B.subtilis amidophosphoribosyltransferase (purF). Probably activates the gene for a degradative protease. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); DNA binding (1); Domain (1); Region (1); Sequence conflict (1) |
| Keywords | Activator;DNA-binding;Direct protein sequencing;Reference proteome;Repressor;Transcription;Transcription regulation |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 36,663 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |