IED ID | IndEnz0002014342 |
Enzyme Type ID | protease014342 |
Protein Name |
Probable isoaspartyl peptidase/L-asparaginase 3 EC 3.4.19.5 L-asparagine amidohydrolase 3 Cleaved into: Isoaspartyl peptidase/L-asparaginase 3 subunit alpha; Isoaspartyl peptidase/L-asparaginase 3 subunit beta |
Gene Name | At5g61540 K11J9.7 |
Organism | Arabidopsis thaliana (Mouse-ear cress) |
Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) |
Enzyme Sequence | MARSDVLIFVSTLLLFLSLLTVADAELVKSDKFPVVVSTWPFLEAVRAAWRAVDNGSSAVEAVVEGCSACEELRCDGTVGPGGSPDENGETMIDALVMDGVTMEVGAVAAMRYVKDGIRAAHLVMKYSQHTLLAGEGASAFAISMGLPGPMNLSSPESVKKWSDWKENQCQPNFRKNVVPANDCGPYKPNNSAMNVFVDKSTESCEMGAIEYKPPLVGPHNHDTISMAVIDRMGHIAVGTSTNGATYKIPGRVGDGPIVGSSAYADDEVGGCGATGDGDTMMRFLPCYQVVESMRQGMKPEEAAKDAISRIARKFPDFVGAVVAVDKNGSHAGACYGWTFQYSVQNPDMNDVQVFTVLP |
Enzyme Length | 359 |
Uniprot Accession Number | Q56W64 |
Absorption | |
Active Site | ACT_SITE 224; /note=Nucleophile; /evidence=ECO:0000250 |
Activity Regulation | |
Binding Site | |
Calcium Binding | |
catalytic Activity | CATALYTIC ACTIVITY: Reaction=Cleavage of a beta-linked Asp residue from the N-terminus of a polypeptide.; EC=3.4.19.5; |
DNA Binding | |
EC Number | 3.4.19.5 |
Enzyme Function | FUNCTION: Acts in asparagine catabolism but also in the final steps of protein degradation via hydrolysis of a range of isoaspartyl dipeptides. {ECO:0000250}. |
Temperature Dependency | |
PH Dependency | |
Pathway | |
nucleotide Binding | |
Features | Active site (1); Alternative sequence (1); Chain (2); Erroneous gene model prediction (1); Region (2); Site (1) |
Keywords | Alternative splicing;Autocatalytic cleavage;Hydrolase;Protease;Reference proteome |
Interact With | |
Induction | |
Subcellular Location | |
Modified Residue | |
Post Translational Modification | PTM: Cleaved into an alpha and beta chain by autocatalysis; this activates the enzyme. The N-terminal residue of the beta subunit is responsible for the nucleophile hydrolase activity (By similarity). {ECO:0000250}. |
Signal Peptide | |
Structure 3D | |
Cross Reference PDB | - |
Mapped Pubmed ID | 12185496; 16705405; 16941220; |
Motif | |
Gene Encoded By | |
Mass | 38,249 |
Kinetics | |
Metal Binding | |
Rhea ID | |
Cross Reference Brenda |