Detail Information for IndEnz0002014363
IED ID IndEnz0002014363
Enzyme Type ID protease014363
Protein Name Lysosomal aspartic protease
EC 3.4.23.-
Gene Name AAEL006169
Organism Aedes aegypti (Yellowfever mosquito) (Culex aegypti)
Taxonomic Lineage cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Protostomia Ecdysozoa Panarthropoda Arthropoda Mandibulata Pancrustacea Hexapoda Insecta Dicondylia Pterygota (winged insects) Neoptera Endopterygota Diptera Nematocera Culicomorpha Culicoidea Culicidae (mosquitos) Culicinae Aedini Aedes Stegomyia Aedes aegypti (Yellowfever mosquito) (Culex aegypti)
Enzyme Sequence MLIKSIIALVCLAVLAQADFVRVQLHKTESARQHFRNVDTEIKQLRLKYNAVSGPVPEPLSNYLDAQYYGAITIGTPPQSFKVVFDTGSSNLWVPSKECSFTNIACLMHNKYNAKKSSTFEKNGTAFHIQYGSGSLSGYLSTDTVGLGGVSVTKQTFAEAINEPGLVFVAAKFDGILGLGYSSISVDGVVPVFYNMFNQGLIDAPVFSFYLNRDPSAAEGGEIIFGGSDSNKYTGDFTYLSVDRKAYWQFKMDSVKVGDTEFCNNGCEAIADTGTSLIAGPVSEVTAINKAIGGTPIMNGEYMVDCSLIPKLPKISFVLGGKSFDLEGADYVLRVAQMGKTICLSGFMGIDIPPPNGPLWILGDVFIGKYYTEFDMGNDRVGFATAV
Enzyme Length 387
Uniprot Accession Number Q03168
Absorption
Active Site ACT_SITE 86; /evidence=ECO:0000255|PROSITE-ProRule:PRU10094; ACT_SITE 272; /evidence=ECO:0000255|PROSITE-ProRule:PRU10094
Activity Regulation
Binding Site
Calcium Binding
catalytic Activity
DNA Binding
EC Number 3.4.23.-
Enzyme Function FUNCTION: May degrade organelles involved in the biosynthesis and secretion of vitellogenin. {ECO:0000269|Ref.3}.
Temperature Dependency
PH Dependency
Pathway
nucleotide Binding
Features Active site (2); Chain (1); Disulfide bond (3); Domain (1); Glycosylation (1); Propeptide (1); Sequence conflict (1); Signal peptide (1)
Keywords Aspartyl protease;Direct protein sequencing;Disulfide bond;Glycoprotein;Hydrolase;Lysosome;Protease;Reference proteome;Signal;Zymogen
Interact With
Induction
Subcellular Location SUBCELLULAR LOCATION: Lysosome {ECO:0000269|Ref.3}.
Modified Residue
Post Translational Modification
Signal Peptide SIGNAL 1..18
Structure 3D
Cross Reference PDB -
Mapped Pubmed ID -
Motif
Gene Encoded By
Mass 41,790
Kinetics
Metal Binding
Rhea ID
Cross Reference Brenda