Detail Information for IndEnz0002014390
IED ID IndEnz0002014390
Enzyme Type ID protease014390
Protein Name Cysteine protease ATG4A
EC 3.4.22.-
AUT-like 2 cysteine endopeptidase
Autophagy-related cysteine endopeptidase 2
Autophagin-2
Autophagy-related protein 4 homolog A
HsAPG4A
hAPG4A
Gene Name ATG4A APG4A AUTL2
Organism Homo sapiens (Human)
Taxonomic Lineage cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Primates Haplorrhini Simiiformes Catarrhini Hominoidea (apes) Hominidae (great apes) Homininae Homo Homo sapiens (Human)
Enzyme Sequence MESVLSKYEDQITIFTDYLEEYPDTDELVWILGKQHLLKTEKSKLLSDISARLWFTYRRKFSPIGGTGPSSDAGWGCMLRCGQMMLAQALICRHLGRDWSWEKQKEQPKEYQRILQCFLDRKDCCYSIHQMAQMGVGEGKSIGEWFGPNTVAQVLKKLALFDEWNSLAVYVSMDNTVVIEDIKKMCRVLPLSADTAGDRPPDSLTASNQSKGTSAYCSAWKPLLLIVPLRLGINQINPVYVDAFKECFKMPQSLGALGGKPNNAYYFIGFLGDELIFLDPHTTQTFVDTEENGTVNDQTFHCLQSPQRMNILNLDPSVALGFFCKEEKDFDNWCSLVQKEILKENLRMFELVQKHPSHWPPFVPPAKPEVTTTGAEFIDSTEQLEEFDLEEDFEILSV
Enzyme Length 398
Uniprot Accession Number Q8WYN0
Absorption
Active Site ACT_SITE 77; /note=Nucleophile; /evidence=ECO:0000250|UniProtKB:Q9Y4P1; ACT_SITE 279; /evidence=ECO:0000250|UniProtKB:Q9Y4P1; ACT_SITE 281; /evidence=ECO:0000250|UniProtKB:Q9Y4P1
Activity Regulation ACTIVITY REGULATION: Inhibited by N-ethylmaleimide (PubMed:12473658, PubMed:21177865). Redox-regulated during autophagy since reducing conditions activate ATG4A whereas an oxidizing environment such as the presence of H(2)O(2) inhibits its activity (PubMed:17347651). {ECO:0000269|PubMed:12473658, ECO:0000269|PubMed:17347651, ECO:0000269|PubMed:21177865}.
Binding Site
Calcium Binding
catalytic Activity CATALYTIC ACTIVITY: Reaction=[protein]-C-terminal L-amino acid-glycyl-phosphatidylethanolamide + H2O = [protein]-C-terminal L-amino acid-glycine + a 1,2-diacyl-sn-glycero-3-phosphoethanolamine; Xref=Rhea:RHEA:67548, Rhea:RHEA-COMP:17323, Rhea:RHEA-COMP:17324, ChEBI:CHEBI:15377, ChEBI:CHEBI:64612, ChEBI:CHEBI:172940, ChEBI:CHEBI:172941; Evidence={ECO:0000269|PubMed:29458288, ECO:0000269|PubMed:33909989};PhysiologicalDirection=left-to-right; Xref=Rhea:RHEA:67549; Evidence={ECO:0000269|PubMed:29458288, ECO:0000269|PubMed:33909989};
DNA Binding
EC Number 3.4.22.-
Enzyme Function FUNCTION: Cysteine protease that plays a key role in autophagy by mediating both proteolytic activation and delipidation of ATG8 family proteins (PubMed:15169837, PubMed:12473658, PubMed:17347651, PubMed:21177865, PubMed:21245471, PubMed:22302004, PubMed:32732290). The protease activity is required for proteolytic activation of ATG8 family proteins: cleaves the C-terminal amino acid of ATG8 proteins to reveal a C-terminal glycine (PubMed:15169837, PubMed:12473658, PubMed:17347651, PubMed:21177865, PubMed:21245471, PubMed:22302004). Exposure of the glycine at the C-terminus is essential for ATG8 proteins conjugation to phosphatidylethanolamine (PE) and insertion to membranes, which is necessary for autophagy (PubMed:15169837, PubMed:12473658, PubMed:17347651, PubMed:21177865, PubMed:21245471, PubMed:22302004). Preferred substrate is GABARAPL2 followed by MAP1LC3A and GABARAP (PubMed:15169837, PubMed:12473658, PubMed:17347651, PubMed:21177865, PubMed:21245471, PubMed:22302004). Protease activity is also required to counteract formation of high-molecular weight conjugates of ATG8 proteins (ATG8ylation): acts as a deubiquitinating-like enzyme that removes ATG8 conjugated to other proteins, such as ATG3 (PubMed:31315929, PubMed:33773106). In addition to the protease activity, also mediates delipidation of ATG8 family proteins (PubMed:29458288, PubMed:33909989). Catalyzes delipidation of PE-conjugated forms of ATG8 proteins during macroautophagy (PubMed:29458288, PubMed:33909989). Compared to ATG4B, the major protein for proteolytic activation of ATG8 proteins, shows weaker ability to cleave the C-terminal amino acid of ATG8 proteins, while it displays stronger delipidation activity (PubMed:29458288). Involved in phagophore growth during mitophagy independently of its protease activity and of ATG8 proteins: acts by regulating ATG9A trafficking to mitochondria and promoting phagophore-endoplasmic reticulum contacts during the lipid transfer phase of mitophagy (PubMed:33773106). {ECO:0000269|PubMed:12473658, ECO:0000269|PubMed:15169837, ECO:0000269|PubMed:17347651, ECO:0000269|PubMed:21177865, ECO:0000269|PubMed:21245471, ECO:0000269|PubMed:22302004, ECO:0000269|PubMed:29458288, ECO:0000269|PubMed:31315929, ECO:0000269|PubMed:32732290, ECO:0000269|PubMed:33773106, ECO:0000269|PubMed:33909989}.
Temperature Dependency
PH Dependency
Pathway
nucleotide Binding
Features Active site (3); Alternative sequence (3); Beta strand (16); Chain (1); Helix (11); Motif (1); Mutagenesis (3); Sequence conflict (3); Turn (6)
Keywords 3D-structure;Alternative splicing;Autophagy;Cytoplasm;Hydrolase;Lipid metabolism;Protease;Protein transport;Reference proteome;Thiol protease;Transport;Ubl conjugation pathway
Interact With Q8IVW4; Q9H0R8
Induction
Subcellular Location SUBCELLULAR LOCATION: Cytoplasm {ECO:0000250|UniProtKB:Q8BGE6}.
Modified Residue
Post Translational Modification
Signal Peptide
Structure 3D X-ray crystallography (1)
Cross Reference PDB 2P82;
Mapped Pubmed ID 15187094; 19322194; 20010802; 20562859; 20819778; 21122541; 21297227; 23508006; 24229464; 24256813; 25416956; 25426560; 26061994; 26496610; 27276686; 28253956; 30661429; 32384281; 32626969; 33310865;
Motif MOTIF 393..396; /note=LIR; /evidence=ECO:0000269|PubMed:28287329
Gene Encoded By
Mass 45,378
Kinetics BIOPHYSICOCHEMICAL PROPERTIES: Kinetic parameters: KM=33.9 uM for MAP1LC3B {ECO:0000269|PubMed:21177865, ECO:0000269|PubMed:22302004}; KM=20.8 uM for GABARAP {ECO:0000269|PubMed:21177865, ECO:0000269|PubMed:22302004}; KM=36.7 uM for GABARAPL1 {ECO:0000269|PubMed:21177865, ECO:0000269|PubMed:22302004}; KM=15.7 uM for GABARAPL2 {ECO:0000269|PubMed:21177865, ECO:0000269|PubMed:22302004};
Metal Binding
Rhea ID RHEA:67548; RHEA:67549
Cross Reference Brenda