| IED ID | IndEnz0002014457 |
| Enzyme Type ID | protease014457 |
| Protein Name |
Alpha-1-antitrypsin Alpha-1 protease inhibitor Alpha-1-antiproteinase Serpin A1 Fragment |
| Gene Name | SERPINA1 |
| Organism | Chlorocebus aethiops (Green monkey) (Cercopithecus aethiops) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Primates Haplorrhini Simiiformes Catarrhini Cercopithecoidea Cercopithecidae (Old World monkeys) Cercopithecinae Chlorocebus Chlorocebus aethiops (Green monkey) (Cercopithecus aethiops) |
| Enzyme Sequence | HVEDPQGDAAQKTDTSHHDQEHSTFNKITPSLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHSEILEGLNFNLTEIPEAQIHEGFQELLHTLNKPDSQLQLTTGNGLFLNKSVKVVDKFLEDVKKLYHSEAFSVNFEDTEEAKKQINNYVEKGTQGKIVDLVKELDRDTVFALVNYIFFKGKWERPFEVEATKEEDFHVDQATTVKVPMMRRLGMFNIYHCEKLSSWVLLMKYLGNATAIFFLPDEGKLQHLENELTHDIITKFLENENRRSANLHLPKLAITGTYDLKTVLGHLGITKVFSNGADLSGVTEDAPLKLSKAVHKAVLTIDEKGTEAAGAMFLEAIPMSIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK |
| Enzyme Length | 396 |
| Uniprot Accession Number | O00394 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Inhibitor of serine proteases. Its primary target is elastase, but it also has a moderate affinity for plasmin and thrombin. Inhibits trypsin, chymotrypsin and plasminogen activator (By similarity). {ECO:0000250}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Glycosylation (4); Modified residue (2); Non-terminal residue (1); Region (2); Signal peptide (1); Site (1) |
| Keywords | Acute phase;Glycoprotein;Phosphoprotein;Protease inhibitor;Secreted;Serine protease inhibitor;Signal |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000250}. |
| Modified Residue | MOD_RES 16; /note=Phosphoserine; /evidence=ECO:0000250|UniProtKB:P01009; MOD_RES 361; /note=Phosphoserine; /evidence=ECO:0000250|UniProtKB:P01009 |
| Post Translational Modification | |
| Signal Peptide | SIGNAL <1..2; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 44,587 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |