| IED ID | IndEnz0002014460 |
| Enzyme Type ID | protease014460 |
| Protein Name |
Alpha-1-antiproteinase Alpha-1-antitrypsin AAT Alpha-1-proteinase inhibitor Serpin A1 |
| Gene Name | Serpina1 |
| Organism | Mus caroli (Ryukyu mouse) (Ricefield mouse) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Glires (Rodents and rabbits) Rodentia Myomorpha (mice and others) Muroidea Muridae Murinae Mus Mus Mus caroli (Ryukyu mouse) (Ricefield mouse) |
| Enzyme Sequence | MTPSISWGLLLLAGLFCLVPSFLAEDVQETDTSRRDSVPASHDTPYNLELSISLYRELGHKSTTSNIFFSQVSIATAFAMLSLGEKGDTHTQILEGLQFNLTQTSEADIHKAFQHLLQTLNRPDSELQLSTGNGSLLNNDLKLVEKFLEEAKNNYHSEVFSVNFAESEEAKKVINDFVEKGTQGKIAEAVKDPDEDTVFALANYILFKGKWKKPFDPKHTEEAEFHVDTVTTVKVPMMTLTGMLDVHHCSTLSSWVLLMDYLGNRTAVFLLPDDGKMQHLEQTLNKELISKFLLNRHRRLAQVHLPRLSLSGNYTLNTLMSHLGITRIFNNGADLSGITEENAPLKLSKAADKAVLTMDETGTEAAAATVLQAVPMSMPPILNFNKPFIFIIVEEHTQSPLFVGKVVDPTRK |
| Enzyme Length | 412 |
| Uniprot Accession Number | P26595 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Inhibitor of serine proteases. Its primary target is elastase, but it also has a moderate affinity for plasmin and thrombin. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Glycosylation (4); Modified residue (2); Region (1); Signal peptide (1); Site (1) |
| Keywords | Glycoprotein;Phosphoprotein;Protease inhibitor;Secreted;Serine protease inhibitor;Signal |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted. |
| Modified Residue | MOD_RES 33; /note=Phosphoserine; /evidence=ECO:0000250|UniProtKB:P01009; MOD_RES 377; /note=Phosphoserine; /evidence=ECO:0000250|UniProtKB:P01009 |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..24 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 45,872 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |