| IED ID | IndEnz0002014470 |
| Enzyme Type ID | protease014470 |
| Protein Name |
Bone morphogenetic protein 4 BMP-4 sBmp4 |
| Gene Name | BMP4 |
| Organism | Suncus murinus (Asian house shrew) (Musk shrew) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Laurasiatheria Eulipotyphla (hedgehogs shrews moles and others) Soricidae (shrews) Crocidurinae Suncus (musk shrews) Suncus murinus (Asian house shrew) (Musk shrew) |
| Enzyme Sequence | MIPGNRMLMVVLLCQVLLGGASHASLIPETGKKKVAEIQGHAGGRRSGQSHELLRDFEATLLQMFGLRRRPQPSKSAVIPDYMRDLYRLQSGEEEEEEQIRSIDLEYPERPTSRANTVRSFHHEEHLEDIPGTSENSAFRFFFNLSSIPENEVISSAELRLFREQVDQGPDWEQGFHRINIYEVMKPPAEVVPGHLITRLLDTRLVHHNVTRWETFDVSPAVLRWTREKQPNYGLAIEVTHLHQTRTHQGQHVRISRSLPQGNGDWAQLRPLLVTFGHDGRGHALTRRRRAKRSPKHHPQRARKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR |
| Enzyme Length | 409 |
| Uniprot Accession Number | Q8MJV5 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Growth factor of the TGF-beta superfamily that plays essential roles in many developmental processes, including neurogenesis, vascular development, angiogenesis and osteogenesis (By similarity). Acts in concert with PTHLH/PTHRP to stimulate ductal outgrowth during embryonic mammary development and to inhibit hair follicle induction (By similarity). Initiates the canonical BMP signaling cascade by associating with type I receptor BMPR1A and type II receptor BMPR2. Once all three components are bound together in a complex at the cell surface, BMPR2 phosphorylates and activates BMPR1A. In turn, BMPR1A propagates signal by phosphorylating SMAD1/5/8 that travel to the nucleus and act as activators and repressors of transcription of target genes. Can also signal through non-canonical BMP pathways such as ERK/MAP kinase, PI3K/Akt, or SRC cascades. For example, induces SRC phosphorylation which, in turn, activates VEGFR2, leading to an angiogenic response (By similarity). {ECO:0000250|UniProtKB:P12644, ECO:0000250|UniProtKB:P21275}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (4); Glycosylation (4); Modified residue (1); Propeptide (1); Region (1); Signal peptide (1) |
| Keywords | Chondrogenesis;Cleavage on pair of basic residues;Cytokine;Developmental protein;Differentiation;Disulfide bond;Extracellular matrix;Glycoprotein;Growth factor;Osteogenesis;Phosphoprotein;Secreted;Signal |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted, extracellular space, extracellular matrix {ECO:0000250}. |
| Modified Residue | MOD_RES 91; /note=Phosphoserine; /evidence=ECO:0000250|UniProtKB:P12644 |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..19; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 46,848 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |