| IED ID | IndEnz0002014483 |
| Enzyme Type ID | protease014483 |
| Protein Name |
Alpha-2-macroglobulin homolog Alpha-2-M Fragments |
| Gene Name | |
| Organism | Homarus americanus (American lobster) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Protostomia Ecdysozoa Panarthropoda Arthropoda Mandibulata Pancrustacea Crustacea Multicrustacea Malacostraca Eumalacostraca Eucarida Decapoda Pleocyemata Astacidea (true lobsters and crayfishes) Nephropoidea Nephropidae (clawed lobsters) Homarus Homarus americanus (American lobster) |
| Enzyme Sequence | SYIITTPRMWVAGSPAQVRTYVMPYGCGEQNMVNFAPN |
| Enzyme Length | 38 |
| Uniprot Accession Number | P20737 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Is able to inhibit all four classes of proteinases by a unique 'trapping' mechanism. This protein has a peptide stretch, called the 'bait region' which contains specific cleavage sites for different proteinases. When a proteinase cleaves the bait region, a conformational change is induced in the protein which traps the proteinase. The entrapped enzyme remains active against low molecular weight substrates (activity against high molecular weight substrates is greatly reduced). Following cleavage in the bait region a thioester bond is hydrolyzed and mediates the covalent binding of the protein to the proteinase. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Cross-link (1); Non-adjacent residues (1); Non-terminal residue (1) |
| Keywords | Bait region;Direct protein sequencing;Disulfide bond;Protease inhibitor;Secreted;Serine protease inhibitor;Thioester bond |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 4,251 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |