| IED ID | IndEnz0002014492 |
| Enzyme Type ID | protease014492 |
| Protein Name |
Kunitz-type serine protease inhibitor A BmTI-A Fragments |
| Gene Name | |
| Organism | Rhipicephalus microplus (Cattle tick) (Boophilus microplus) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Protostomia Ecdysozoa Panarthropoda Arthropoda Chelicerata Arachnida Acari Parasitiformes Ixodida (ticks) Ixodoidea Ixodidae (hardbacked ticks) Rhipicephalinae Rhipicephalus Boophilus Rhipicephalus microplus (Cattle tick) (Boophilus microplus) |
| Enzyme Sequence | SQPHVNPFACYVAPDQGPCRAILRYYFDDDTQTCQRFTYGGCEGNANNXXXXEQCKASCKPETEYEAKKCLARPESGPCLAYMPMWGYDSKLGQCVEFIYGGCDGNDNKYTTEEECLKSCK |
| Enzyme Length | 121 |
| Uniprot Accession Number | P83609 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Inhibits bovine trypsin, bovine chymotrypsin, human plasmin, human plasma kallikrein and human neutrophil elastase, but not bovine thrombin, human factor Xa or porcine pancreatic kallikrein. May play a role in blocking blood coagulation during the larvae fixation on cattle. {ECO:0000269|PubMed:10615008, ECO:0000269|PubMed:15556274}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (6); Domain (2); Non-adjacent residues (1); Non-terminal residue (1); Site (2) |
| Keywords | Direct protein sequencing;Disulfide bond;Protease inhibitor;Repeat;Secreted;Serine protease inhibitor |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 13,592 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |