| IED ID | IndEnz0002014501 |
| Enzyme Type ID | protease014501 |
| Protein Name |
Bradykinin-potentiating and C-type natriuretic peptides Angiotensin-converting enzyme inhibitor BPP-CNP homolog Cleaved into: Blomhotin; Bradykinin-potentiating peptide A BPP-a Potentiator A ; Leu3-blomhotin Potentiator D ; Bradykinin-potentiating peptide B BPP-b Potentiator B ; Bradykinin-potentiating peptide C BPP-c Potentiator C ; Bradykinin-potentiating peptide E BPP-e Potentiator E ; Bradykinin-potentiating peptide Ahb1 BPP-Ahb1 ; Bradykinin-potentiating peptide Ahb2 BPP-Ahb2 ; C-type natriuretic peptide |
| Gene Name | |
| Organism | Gloydius blomhoffii (Mamushi) (Agkistrodon halys blomhoffi) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Sauropsida Sauria (diapsids) Lepidosauria (lepidosaurs) Squamata (squamates) Bifurcata (split-tongued squamates) Unidentata Episquamata Toxicofera Serpentes (snakes) Colubroidea Viperidae Crotalinae (pit vipers) Gloydius Gloydius blomhoffii (Mamushi) (Agkistrodon halys blomhoffi) |
| Enzyme Sequence | MFVSRLAASGLLLLALMALSLDGKPVQQWSQGRPPGPPIPRLVVQQWSQGLPPGPPIPRLVVQQWSQGLPPGPPIPPLVVQQWSQGLPPRPKIPPLVVQQWSQGLPPRPKIPPLVVQKWDPPPVSPPLLLQPHESPAGGTTALREELSLGPEAASGPAAAGADGGRSGSKAPAALHRLSKSKGASATSASASRPMRDLRTDGKQARQNWARMVNPDHHAVGGCCCGGGGGGARRLKGLVKKGVAKGCFGLKLDRIGTMSGLGC |
| Enzyme Length | 263 |
| Uniprot Accession Number | P01021 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: [Blomhotin]: Inhibits the rabbit lung angiotensin-converting enzyme (ACE) (IC(50)=15 uM) (PubMed:10866809). Contracts the rat gastric fundus smooth muscle in a rapid and transient manner (PubMed:10519653, PubMed:10866809). {ECO:0000269|PubMed:10519653, ECO:0000269|PubMed:10866809}.; FUNCTION: [Bradykinin-potentiating peptide A]: Causes no contraction of the rat gastric fundus smooth muscle even at high concentrations. Causes very weak contraction of the isolated guinea pig ileum (PubMed:4323853). Causes weak contraction on rat uterus (PubMed:4323853). {ECO:0000269|PubMed:4323853}.; FUNCTION: [Bradykinin-potentiating peptide B]: Inhibits the activity of the angiotensin-converting enzyme (ACE) by a preferential interaction with its C-domain (Ki=30 nM, IC(50)=1.1 uM) (PubMed:10866809, PubMed:11994001, PubMed:23082758). It binds ACE in a zinc-independent manner (PubMed:23056909). Also potentiates the hypotensive effects of bradykinin. Causes high contraction of the isolated guinea pig ileum and weak contraction on rat uterus (PubMed:4323853). {ECO:0000269|PubMed:10866809, ECO:0000269|PubMed:11994001, ECO:0000269|PubMed:23082758, ECO:0000269|PubMed:4323853}.; FUNCTION: [Bradykinin-potentiating peptide C]: Inhibits the activity of the angiotensin-converting enzyme (ACE) by interacting with the same potency to its C- and N-domains (PubMed:11994001). Inhibits the rabbit lung angiotensin-converting enzyme (ACE) (IC(50)=7.1 uM) (PubMed:10866809). Causes weak contraction of the isolated guinea pig ileum (PubMed:4323853). Causes weak contraction on rat uterus (PubMed:4323853). {ECO:0000269|PubMed:10866809, ECO:0000269|PubMed:11994001, ECO:0000269|PubMed:4323853}.; FUNCTION: [Leu3-blomhotin]: Inhibits the rabbit lung angiotensin-converting enzyme (ACE) (IC(50)=46 uM) (PubMed:10866809). Synthetic Leu3-blomhotin contracts the rat gastric fundus smooth muscle in a rapid and transient manner (PubMed:10866809). Causes moderate contraction of the isolated guinea pig ileum (PubMed:4323853). Causes weak contraction on rat uterus (PubMed:4323853). {ECO:0000269|PubMed:10866809, ECO:0000269|PubMed:4323853}.; FUNCTION: [Bradykinin-potentiating peptide E]: Causes weak contraction of the isolated guinea pig ileum (PubMed:4323853). Causes about 50-fold more potentiating activity on rat uterus than on guinea pig ileum (PubMed:4323853). {ECO:0000269|PubMed:4323853}.; FUNCTION: [Bradykinin-potentiating peptide Ahb1]: Synthetic peptide potentiates the bradykinin in vivo. {ECO:0000269|PubMed:11994001}.; FUNCTION: [Bradykinin-potentiating peptide Ahb2]: Synthetic peptide does not show any bradykinin-potentiating effects. {ECO:0000269|PubMed:11994001}.; FUNCTION: [C-type natriuretic peptide]: Exhibits hypotensive and vasodepressor activity. Acts by activating natriuretic receptors (NPR1 and/or NPR2 and/or NPR3) (By similarity). {ECO:0000250}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Disulfide bond (1); Modified residue (7); Peptide (10); Propeptide (7); Region (4); Signal peptide (1); Site (2) |
| Keywords | 3D-structure;Cleavage on pair of basic residues;Direct protein sequencing;Disulfide bond;Hypotensive agent;Metalloenzyme inhibitor;Metalloprotease inhibitor;Protease inhibitor;Pyrrolidone carboxylic acid;Repeat;Secreted;Signal;Toxin;Vasoactive;Vasodilator |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000269|PubMed:10519653, ECO:0000269|PubMed:10866809, ECO:0000269|PubMed:4323853, ECO:0000269|PubMed:4730295, ECO:0000269|Ref.5}. |
| Modified Residue | MOD_RES 31; /note="Pyrrolidone carboxylic acid"; /evidence="ECO:0000269|PubMed:10519653, ECO:0000269|PubMed:4730295"; MOD_RES 49; /note="Pyrrolidone carboxylic acid"; /evidence="ECO:0000269|PubMed:10866809"; MOD_RES 67; /note="Pyrrolidone carboxylic acid"; /evidence="ECO:0000269|PubMed:4323853"; MOD_RES 85; /note="Pyrrolidone carboxylic acid"; /evidence="ECO:0000269|Ref.5"; MOD_RES 103; /note="Pyrrolidone carboxylic acid"; /evidence="ECO:0000269|Ref.5"; MOD_RES 117; /note="Pyrrolidone carboxylic acid"; /evidence="ECO:0000303|PubMed:17714693"; MOD_RES 131; /note="Pyrrolidone carboxylic acid"; /evidence="ECO:0000303|PubMed:17714693" |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..23; /evidence=ECO:0000255 |
| Structure 3D | X-ray crystallography (2) |
| Cross Reference PDB | 4AA2; 4APJ; |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 27,339 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |