| IED ID | IndEnz0002014505 |
| Enzyme Type ID | protease014505 |
| Protein Name |
Chymotrypsin inhibitor AMCI |
| Gene Name | |
| Organism | Apis mellifera (Honeybee) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Protostomia Ecdysozoa Panarthropoda Arthropoda Mandibulata Pancrustacea Hexapoda Insecta Dicondylia Pterygota (winged insects) Neoptera Endopterygota Hymenoptera Apocrita (wasps ants and bees) Aculeata Apoidea (bees) Apidae (bumble bees and honey bees) Apinae (honey bees) Apini Apis Apis mellifera (Honeybee) |
| Enzyme Sequence | EECGPNEVFNTCGSACAPTCAQPKTRICTMQCRIGCQCQEGFLRNGEGACVLPENC |
| Enzyme Length | 56 |
| Uniprot Accession Number | P56682 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Chymotrypsin and cathepsin G inhibitor. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Beta strand (5); Chain (1); Disulfide bond (5); Domain (1); Helix (1); Turn (1) |
| Keywords | 3D-structure;Direct protein sequencing;Disulfide bond;Protease inhibitor;Reference proteome;Secreted;Serine protease inhibitor |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | NMR spectroscopy (1) |
| Cross Reference PDB | 1CCV; |
| Mapped Pubmed ID | 10850807; |
| Motif | |
| Gene Encoded By | |
| Mass | 5,973 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |