| IED ID | IndEnz0002014545 |
| Enzyme Type ID | protease014545 |
| Protein Name |
Antitoxin CcdA LynA Protein H Protein LetA |
| Gene Name | ccdA H letA ECOK12F042 |
| Organism | Escherichia coli (strain K12) |
| Taxonomic Lineage | cellular organisms Bacteria Proteobacteria Gammaproteobacteria Enterobacterales Enterobacteriaceae Escherichia Escherichia coli Escherichia coli (strain K12) |
| Enzyme Sequence | MKQRITVTVDSDSYQLLKAYDVNISGLVSTTMQNEARRLRAERWKAENQEGMAEVARFIEMNGSFADENRDW |
| Enzyme Length | 72 |
| Uniprot Accession Number | P62552 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Antitoxin component of a type II toxin-antitoxin (TA) system which inhibits the post-segregational killing (PSK) of plasmid-free cells, also referred to as a plasmid addiction system. Labile antitoxin with a half-life of about 1 hour in the presence of CcdB. Binds to and blocks the activity of CcdB; will also remove bound CcdB protein from the CcdB-GyrA complex by forming a CcdA-CcdB complex, a process termed rejuvenation. The N-terminal 36 residues are not required for rejuventation. Functions as a transcriptional corepressor for the ccdAB operon, repression also requires CcdB. {ECO:0000269|PubMed:1324324, ECO:0000269|PubMed:19647513, ECO:0000269|PubMed:2615761, ECO:0000269|PubMed:2651399, ECO:0000269|PubMed:6308648, ECO:0000269|PubMed:6327993, ECO:0000269|PubMed:8604132}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Beta strand (2); Chain (1); Helix (4); Mutagenesis (3); Region (3) |
| Keywords | 3D-structure;DNA-binding;Direct protein sequencing;Plasmid;Repressor;Toxin-antitoxin system;Transcription;Transcription regulation |
| Interact With | P62554 |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | PTM: Degraded by the Lon protease. |
| Signal Peptide | |
| Structure 3D | NMR spectroscopy (4); X-ray crystallography (2) |
| Cross Reference PDB | 2ADL; 2ADN; 2H3A; 2H3C; 3G7Z; 3HPW; |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | Plasmid F |
| Mass | 8,372 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |