| IED ID | IndEnz0002014566 |
| Enzyme Type ID | protease014566 |
| Protein Name |
Aspartic protease inhibitor 10 Wound-induced aspartate proteinase CDI inhibitor |
| Gene Name | CDI |
| Organism | Solanum tuberosum (Potato) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae asterids lamiids Solanales Solanaceae Solanoideae Solaneae Solanum Solanum tuberosum (Potato) |
| Enzyme Sequence | MMKCLFLLCLCLVPIVVFSSTFTSQNLIDLPSESPLPKPVLDTNGKELNPNSSYRIISIGRGALGGDVYLGKSPNSDAPCPDGVFRYNSDVGPSGTPVRFIPLSGGIFEDQLLNIQFNIPTVRLCVSYTIWKVGINAYLRTMLLETGGTIGQADSSYFKIVKSSILGYNLLYCPITRPILCPFCRDDDFCAKVGVVIQKGKRRLALVNENPLDVNFKEV |
| Enzyme Length | 219 |
| Uniprot Accession Number | Q03197 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Inhibitor of cathepsin D (aspartic protease) and trypsin (serine protease). Protects the plant by inhibiting proteases of invading organisms. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (2); Glycosylation (1); Motif (1); Propeptide (1); Signal peptide (1); Site (2) |
| Keywords | Aspartic protease inhibitor;Disulfide bond;Glycoprotein;Protease inhibitor;Reference proteome;Serine protease inhibitor;Signal;Stress response |
| Interact With | |
| Induction | INDUCTION: By abscisic acid (ABA), jasmonic acid (JA) and wounding. |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..23; /evidence=ECO:0000250 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | MOTIF 26..31; /note=Vacuolar targeting signal; /evidence=ECO:0000250 |
| Gene Encoded By | |
| Mass | 24,035 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |