| IED ID | IndEnz0002014616 |
| Enzyme Type ID | protease014616 |
| Protein Name |
Salivary cystatin-L Sialostatin-L SialoL |
| Gene Name | |
| Organism | Ixodes scapularis (Black-legged tick) (Deer tick) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Protostomia Ecdysozoa Panarthropoda Arthropoda Chelicerata Arachnida Acari Parasitiformes Ixodida (ticks) Ixodoidea Ixodidae (hardbacked ticks) Ixodinae Ixodes Ixodes scapularis (Black-legged tick) (Deer tick) |
| Enzyme Sequence | MTSTFALVLLLGGMAVCVATGVFGGYSERANHQANPEFLNLAHYATSTWSAQQPGKTHFDTVAEVVKVETQVVAGTNYRLTLKVAESTCELTSTYNKDTCLPKADAAHRTCTTVVFENLQGDKSVSPFECEAA |
| Enzyme Length | 133 |
| Uniprot Accession Number | Q8MVB6 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Inhibitor of cysteine proteinases. Inhibits host immune responses via its inhibition of host cathepsins (PubMed:19494265). Contributes to the suppression of the host's immune response to tick salivary proteins and is important for successful feeding on hosts (PubMed:17698852). Inhibits differentiation of host dendritic cells (PubMed:19494265, PubMed:25975355). Inhibits proliferation of host T-cells in response to antigen stimulus (PubMed:19494265). Down-regulates TLR2-mediated host responses to infection by B.burgdorferi and the production of the chemokine CCL3 by host dendritic cells (PubMed:25975355). Down-regulates host responses to infection by B.burgdorferi and the production of IFNB1 by host dendritic cells (PubMed:25975355). Down-regulates IL1B production by host mast cells, and this then leads to impaired activation of IL1R1, resulting in decreased IL9 production (PubMed:26078269). Inhibits host inflammatory reactions and recruitment of host neutrophils (PubMed:16772304). Inhibits papain and cathepsin-L (CTSL) (in vitro) (PubMed:16772304, PubMed:17698852, PubMed:20545851). Inhibits cathepsin-S (CTSS) (in vitro) (PubMed:17698852, PubMed:20545851). Inhibits CTSV and CTSC, but to a lesser degree (in vitro) (PubMed:16772304, PubMed:17698852). {ECO:0000269|PubMed:16772304, ECO:0000269|PubMed:17698852, ECO:0000269|PubMed:19494265, ECO:0000269|PubMed:20545851, ECO:0000269|PubMed:25975355, ECO:0000269|PubMed:26078269}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Beta strand (3); Chain (1); Disulfide bond (2); Domain (1); Helix (1); Signal peptide (1); Site (1); Turn (1) |
| Keywords | 3D-structure;Disulfide bond;Protease inhibitor;Reference proteome;Secreted;Signal;Thiol protease inhibitor |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000269|PubMed:16772304}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..19; /evidence=ECO:0000255 |
| Structure 3D | X-ray crystallography (1) |
| Cross Reference PDB | 4ZM8; |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 14,282 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |