| IED ID | IndEnz0002014618 |
| Enzyme Type ID | protease014618 |
| Protein Name |
DNA-binding protein DBP Early 2A protein Early E2A DNA-binding protein |
| Gene Name | DBP |
| Organism | Human adenovirus F serotype 40 (HAdV-40) (Human adenovirus 40) |
| Taxonomic Lineage | Viruses Varidnaviria Bamfordvirae Preplasmiviricota Tectiliviricetes Rowavirales Adenoviridae Mastadenovirus Human mastadenovirus F Human adenovirus F serotype 40 (HAdV-40) (Human adenovirus 40) |
| Enzyme Sequence | MAGRQQELPTITPYLQETSPERAPSLPPKKKLRKNVQVPDRVPVLPPSPEVVPDSEEEEEEVVYTGFSHPGVQVVQKASGKRYVRRLEPKGVPPPSEENNEEEEPSTSKAVTSVVLNPQAEPLVSAWEKGMDLMIKLMEKYHVEAEEKNGFKFLPEQSNVYRKICQTWLNEEHRGLPLTFTSHKTFVEMMGRFLRAYVESYAGVKNNEWEPTGCAIWLHGCTEQEGVLRCYHGLEMIQKEQLVEMDVASENAQRALKEHPSRAKVVQNRWGRSVVQLKNDDARCCVEDVSCATNVFSAKSCGLFFSEGTKAQTAFLQIEAFMQAEYPKMQNGLKRLLMVMRCDCLYKPTGVPQLGRQMCKATPFALSNVDSLRAEEVTDKVALASIQYPCVLVYQCANPVYRNSRGGQGPNCDFKISAPDLLGALQLVRRLWGENVDGPLPKMLIPEFKWSSRLQYRNVALPASHGDGEKEPF |
| Enzyme Length | 473 |
| Uniprot Accession Number | P11806 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Plays a role in the elongation phase of viral strand displacement replication by unwinding the template in an ATP-independent fashion, employing its capacity to form multimers. Also enhances the rate of initiation. Released from template upon second strand synthesis. Assembles in complex with viral pTP, viral pol, host NFIA and host POU2F1/OCT1 on viral origin of replication. Covers the whole ssDNA genome during synthesis. The complementary strand synthesis induces its relese from DNA template. May inhibit cellular transcription mediated by the interaction between host SRCAP and CBP. {ECO:0000255|HAMAP-Rule:MF_04054}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Compositional bias (1); Metal binding (8); Modified residue (1); Region (4) |
| Keywords | DNA replication;DNA-binding;Early protein;Host nucleus;Host-virus interaction;Metal-binding;Phosphoprotein;Viral DNA replication;Zinc |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Host nucleus {ECO:0000255|HAMAP-Rule:MF_04054}. Note=Accumulates in infected cells. {ECO:0000255|HAMAP-Rule:MF_04054}. |
| Modified Residue | MOD_RES 141; /note=Phosphotyrosine; by host; /evidence=ECO:0000255|HAMAP-Rule:MF_04054 |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 53,335 |
| Kinetics | |
| Metal Binding | METAL 230; /note=Zinc 1; /evidence=ECO:0000255|HAMAP-Rule:MF_04054; METAL 232; /note=Zinc 1; /evidence=ECO:0000255|HAMAP-Rule:MF_04054; METAL 285; /note=Zinc 1; /evidence=ECO:0000255|HAMAP-Rule:MF_04054; METAL 301; /note=Zinc 1; /evidence=ECO:0000255|HAMAP-Rule:MF_04054; METAL 342; /note=Zinc 2; /evidence=ECO:0000255|HAMAP-Rule:MF_04054; METAL 344; /note=Zinc 2; /evidence=ECO:0000255|HAMAP-Rule:MF_04054; METAL 396; /note=Zinc 2; /evidence=ECO:0000255|HAMAP-Rule:MF_04054; METAL 412; /note=Zinc 2; /evidence=ECO:0000255|HAMAP-Rule:MF_04054 |
| Rhea ID | |
| Cross Reference Brenda |