IED ID | IndEnz0002014784 |
Enzyme Type ID | protease014784 |
Protein Name |
ATP-dependent protease subunit HslV EC 3.4.25.2 |
Gene Name | hslV Mext_0644 |
Organism | Methylorubrum extorquens (strain PA1) (Methylobacterium extorquens) |
Taxonomic Lineage | cellular organisms Bacteria Proteobacteria Alphaproteobacteria Hyphomicrobiales Methylobacteriaceae Methylorubrum Methylorubrum extorquens (Methylobacterium dichloromethanicum) (Methylobacterium extorquens) Methylorubrum extorquens (strain PA1) (Methylobacterium extorquens) |
Enzyme Sequence | MAQTDDRLPQMHATTILMVRKGGRVVIGGDGQVSLGQTIVKGNARKVRRLAKGTVIGGFAGATADAFTLFERLEAKLEQYPGQLTRACVELTKDWRTDRYLRRLEAMMLVADKEVSLLLSGAGDVLEPETGVMAIGSGGNYALSAARALEDGELDAEAIVRRSMKIAAEICVYTNGNLVIETLDAA |
Enzyme Length | 186 |
Uniprot Accession Number | A9W0F2 |
Absorption | |
Active Site | ACT_SITE 14; /evidence=ECO:0000255|HAMAP-Rule:MF_00248 |
Activity Regulation | ACTIVITY REGULATION: Allosterically activated by HslU binding. {ECO:0000255|HAMAP-Rule:MF_00248}. |
Binding Site | |
Calcium Binding | |
catalytic Activity | CATALYTIC ACTIVITY: Reaction=ATP-dependent cleavage of peptide bonds with broad specificity.; EC=3.4.25.2; Evidence={ECO:0000255|HAMAP-Rule:MF_00248}; |
DNA Binding | |
EC Number | 3.4.25.2 |
Enzyme Function | FUNCTION: Protease subunit of a proteasome-like degradation complex believed to be a general protein degrading machinery. {ECO:0000255|HAMAP-Rule:MF_00248}. |
Temperature Dependency | |
PH Dependency | |
Pathway | |
nucleotide Binding | |
Features | Active site (1); Chain (1); Metal binding (3) |
Keywords | Allosteric enzyme;Cytoplasm;Hydrolase;Metal-binding;Protease;Sodium;Threonine protease |
Interact With | |
Induction | |
Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000255|HAMAP-Rule:MF_00248}. |
Modified Residue | |
Post Translational Modification | |
Signal Peptide | |
Structure 3D | |
Cross Reference PDB | - |
Mapped Pubmed ID | - |
Motif | |
Gene Encoded By | |
Mass | 19,955 |
Kinetics | |
Metal Binding | METAL 168; /note=Sodium; via carbonyl oxygen; /evidence=ECO:0000255|HAMAP-Rule:MF_00248; METAL 171; /note=Sodium; via carbonyl oxygen; /evidence=ECO:0000255|HAMAP-Rule:MF_00248; METAL 174; /note=Sodium; via carbonyl oxygen; /evidence=ECO:0000255|HAMAP-Rule:MF_00248 |
Rhea ID | |
Cross Reference Brenda |