| IED ID | IndEnz0002015196 |
| Enzyme Type ID | protease015196 |
| Protein Name |
ATP-dependent protease subunit HslV EC 3.4.25.2 Mitochondrial proteasome-like protease HslVU protease subunit |
| Gene Name | HslV Tb11.01.2000 |
| Organism | Trypanosoma brucei brucei (strain 927/4 GUTat10.1) |
| Taxonomic Lineage | cellular organisms Eukaryota Discoba Euglenozoa Kinetoplastea (kinetoplasts) Metakinetoplastina Trypanosomatida Trypanosomatidae Trypanosoma Trypanozoon Trypanosoma brucei Trypanosoma brucei brucei Trypanosoma brucei brucei (strain 927/4 GUTat10.1) |
| Enzyme Sequence | MLRRVGRTTCSPAACQLRHTTILSVRKGDTVVLLGDRQVTLGERIVAKSSACKLRRINDDVVIGFAGSTADAISLMEKLENKIGEFPNQLTRAAVELAKEWRTDRALRRLEASLIVCSAEETLEIDGQGNVITPEADGIVAIGSGGTFAKAAARALIDVDGYDAEKIARKAMRIATDIDVFSNEHWDVEVLKRKSEKQEGSEASAKTSE |
| Enzyme Length | 209 |
| Uniprot Accession Number | Q383Q5 |
| Absorption | |
| Active Site | ACT_SITE 20; /evidence=ECO:0000250 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=ATP-dependent cleavage of peptide bonds with broad specificity.; EC=3.4.25.2; Evidence={ECO:0000269|PubMed:18421378}; |
| DNA Binding | |
| EC Number | 3.4.25.2 |
| Enzyme Function | FUNCTION: Protease subunit of a proteasome-like degradation complex. HslU recognizes protein substrates and unfolds these before guiding them to HslV for hydrolysis. HslV is not believed to degrade folded proteins (By similarity). The HslVU protease complex functions in mitochondrial DNA replication by regulating DNA helicase PIF2 protein levels. {ECO:0000250, ECO:0000269|PubMed:18421378}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (1); Beta strand (10); Chain (1); Helix (5); Mutagenesis (3); Transit peptide (1); Turn (1) |
| Keywords | 3D-structure;Hydrolase;Kinetoplast;Mitochondrion;Protease;Reference proteome;Threonine protease;Transit peptide |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Mitochondrion matrix, kinetoplast {ECO:0000269|PubMed:18421378}. Note=Associated with kinetoplast DNA (kDNA). |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | X-ray crystallography (2) |
| Cross Reference PDB | 4HNZ; 4HO7; |
| Mapped Pubmed ID | 23818520; |
| Motif | |
| Gene Encoded By | |
| Mass | 22,684 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda | 3.4.25.2; |