| IED ID | IndEnz0002015221 |
| Enzyme Type ID | protease015221 |
| Protein Name |
Bowman-birk type proteinase inhibitor 2 TcTI2 |
| Gene Name | |
| Organism | Amburana cearensis (Cerejeira) (Torresea cearensis) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids fabids Fabales Fabaceae Papilionoideae ADA clade Amburaneae Amburana Amburana cearensis (Cerejeira) (Torresea cearensis) |
| Enzyme Sequence | SSKWEACCDRCACTKSIPPQCHCADIRLNSCHSACESCACTHSIPAQCRCFDITDFCYKPCSG |
| Enzyme Length | 63 |
| Uniprot Accession Number | P83283 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Inhibits trypsin, chymotrypsin, plasmin and factor XIIa. Does not inhibit factor Xa, thrombin, human plasma kallikrein, porcine pancreatic kallikrein and human urinary kallikrein. {ECO:0000269|PubMed:9165081}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (7); Site (2) |
| Keywords | Direct protein sequencing;Disulfide bond;Protease inhibitor;Serine protease inhibitor |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 6,897 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |