| IED ID |
IndEnz0002015222 |
| Enzyme Type ID |
protease015222 |
| Protein Name |
Bowman-Birk type proteinase inhibitor B-II
|
| Gene Name |
|
| Organism |
Arachis hypogaea (Peanut) |
| Taxonomic Lineage |
cellular organisms
Eukaryota
Viridiplantae
Streptophyta
Streptophytina
Embryophyta
Tracheophyta
Euphyllophyta
Spermatophyta
Magnoliopsida
Mesangiospermae
eudicotyledons
Gunneridae
Pentapetalae
rosids
fabids
Fabales
Fabaceae
Papilionoideae
50 kb inversion clade
dalbergioids sensu lato
Dalbergieae
Pterocarpus clade
Arachis
Arachis hypogaea (Peanut)
|
| Enzyme Sequence |
AASDCCSACICDRRAPPYFECTCGDTFDHCPAACNKCVCTRSIPPQCRCTDRTQGRCPLTPCA |
| Enzyme Length |
63 |
| Uniprot Accession Number |
P01067 |
| Absorption |
|
| Active Site |
|
| Activity Regulation |
|
| Binding Site |
|
| Calcium Binding |
|
| catalytic Activity |
|
| DNA Binding |
|
| EC Number |
|
| Enzyme Function |
|
| Temperature Dependency |
|
| PH Dependency |
|
| Pathway |
|
| nucleotide Binding |
|
| Features |
Chain (1); Disulfide bond (7); Site (2) |
| Keywords |
Direct protein sequencing;Disulfide bond;Protease inhibitor;Serine protease inhibitor |
| Interact With |
|
| Induction |
|
| Subcellular Location |
|
| Modified Residue |
|
| Post Translational Modification |
|
| Signal Peptide |
|
| Structure 3D |
|
| Cross Reference PDB |
- |
| Mapped Pubmed ID |
- |
| Motif |
|
| Gene Encoded By |
|
| Mass |
6,795 |
| Kinetics |
|
| Metal Binding |
|
| Rhea ID |
|
| Cross Reference Brenda |
|