| IED ID | IndEnz0002015226 |
| Enzyme Type ID | protease015226 |
| Protein Name |
Bowman-Birk type proteinase inhibitor 2 Bowman-Birk type proteinase inhibitor II Cleaved into: Bowman-Birk type proteinase inhibitor 2 long; Bowman-Birk type proteinase inhibitor 2 short |
| Gene Name | BBI |
| Organism | Phaseolus vulgaris (Kidney bean) (French bean) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids fabids Fabales Fabaceae Papilionoideae 50 kb inversion clade NPAAA clade indigoferoid/millettioid clade Phaseoleae Phaseolus Phaseolus vulgaris (Kidney bean) (French bean) |
| Enzyme Sequence | MMVLKVCLLLVFLAGVTTARMDLNHLIGSNHHDSSDEPSESSEPCCDICVCTASIPPICQCTDVRLNSCHSACKSCMCTRSMPGKCRCLDTTDYCYKSCKSSGEDDD |
| Enzyme Length | 107 |
| Uniprot Accession Number | P01060 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: This protein inhibits elastase and trypsin simultaneously and independently. {ECO:0000269|PubMed:4684708}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (2); Disulfide bond (7); Sequence conflict (1); Signal peptide (1); Site (2) |
| Keywords | Direct protein sequencing;Disulfide bond;Protease inhibitor;Serine protease inhibitor;Signal |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | PTM: The N-terminus of Bowman-Birk type proteinase inhibitor 2 long is blocked. |
| Signal Peptide | SIGNAL 1..19; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 11,637 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |