| IED ID | IndEnz0002015256 |
| Enzyme Type ID | protease015256 |
| Protein Name |
Bowman-Birk type proteinase inhibitor EBI |
| Gene Name | |
| Organism | Erythrina variegata (Indian coral tree) (Erythrina indica) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids fabids Fabales Fabaceae Papilionoideae 50 kb inversion clade NPAAA clade indigoferoid/millettioid clade Phaseoleae Erythrina Erythrina variegata (Indian coral tree) (Erythrina indica) |
| Enzyme Sequence | TSACCDKCFCTKSNPPICQCRDVGETCHSACKFCICALSYPAQCHCLDQNTFCYDKCDSDS |
| Enzyme Length | 61 |
| Uniprot Accession Number | P81705 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Strong inhibitor of trypsin with a 1:1 stoichiometry. Weaker inhibitor of chymotrypsin. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (7); Site (2) |
| Keywords | Direct protein sequencing;Disulfide bond;Protease inhibitor;Serine protease inhibitor |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 6,717 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |