| IED ID | IndEnz0002015258 |
| Enzyme Type ID | protease015258 |
| Protein Name |
Bowman-Birk type proteinase inhibitor LCTI Trypsin/chymotrypsin inhibitor |
| Gene Name | |
| Organism | Lens culinaris (Lentil) (Cicer lens) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids fabids Fabales Fabaceae Papilionoideae 50 kb inversion clade NPAAA clade Hologalegina IRL clade Fabeae Lens Lens culinaris (Lentil) (Cicer lens) |
| Enzyme Sequence | MVLMNKKAIMKLALMLFLLGFTANVVDARFDSTSFITQVLSNGDDVKSACCDTCLCTRSQPPTCRCVDVRESCHSACDKCVCAYSNPPQCQCYDTHKFCYKACHNSEIEE |
| Enzyme Length | 110 |
| Uniprot Accession Number | Q8W4Y8 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Inhibitor of trypsin and of chymotrypsin. {ECO:0000269|PubMed:16889634}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Beta strand (5); Chain (1); Disulfide bond (7); Propeptide (1); Sequence conflict (5); Signal peptide (1); Site (2) |
| Keywords | 3D-structure;Direct protein sequencing;Disulfide bond;Protease inhibitor;Serine protease inhibitor;Signal |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..28; /evidence=ECO:0000255 |
| Structure 3D | NMR spectroscopy (1) |
| Cross Reference PDB | 2AIH; |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 12,266 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |