| IED ID | IndEnz0002015259 |
| Enzyme Type ID | protease015259 |
| Protein Name |
Bowman-Birk type proteinase inhibitor MSTI |
| Gene Name | |
| Organism | Medicago scutellata (Snail medic) (Medicago polymorpha var. scutellata) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids fabids Fabales Fabaceae Papilionoideae 50 kb inversion clade NPAAA clade Hologalegina IRL clade Trifolieae Medicago (medics) Medicago scutellata (Snail medic) (Medicago polymorpha var. scutellata) |
| Enzyme Sequence | TKSTTTACCDFCPCTRSIPPQCQCTDVREKCHSACKSCLCTRSFPPQCRCYDITDFCYPSCS |
| Enzyme Length | 62 |
| Uniprot Accession Number | P80321 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Inhibits trypsin but not chymotrypsin. Inhibits the trypsin-like proteinase activity present in larvae of the crop pests Adoxophyes orana, Hyphantria cunea, Lobesia botrana and Ostrinia nubilalis. {ECO:0000269|PubMed:9014368}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Beta strand (6); Chain (1); Disulfide bond (7); Sequence conflict (4); Site (2) |
| Keywords | 3D-structure;Direct protein sequencing;Disulfide bond;Protease inhibitor;Serine protease inhibitor |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | NMR spectroscopy (1); X-ray crystallography (1) |
| Cross Reference PDB | 1MVZ; 2ILN; |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 6,932 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |