| IED ID | IndEnz0002015260 |
| Enzyme Type ID | protease015260 |
| Protein Name |
Bowman-Birk type proteinase inhibitor TBPI-B |
| Gene Name | |
| Organism | Phaseolus acutifolius (Tepary bean) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids fabids Fabales Fabaceae Papilionoideae 50 kb inversion clade NPAAA clade indigoferoid/millettioid clade Phaseoleae Phaseolus Phaseolus acutifolius (Tepary bean) |
| Enzyme Sequence | SGHHHHDSSDEPSESSKACCDHCACTKSIPPQCRCALRLNCNHCRSCICTFSIPAQCVCTDTNDFCYEPCKSGHDDDDSG |
| Enzyme Length | 80 |
| Uniprot Accession Number | P83311 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Protease inhibitor with activity against cysteine, aspartic and serine proteases. Highest activity against serine proteases, in particular trypsin and trypsin-like proteases. {ECO:0000269|Ref.2}. |
| Temperature Dependency | |
| PH Dependency | BIOPHYSICOCHEMICAL PROPERTIES: pH dependence: Stable at acidic pHs. Inhibitory activity is unaffected after 1 hour at pH 3.0 and 96 degrees Celsius. Inactivated after 1 hour at pH 10.7 and 96 degrees Celsius.; |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (7); Site (2) |
| Keywords | Calcium;Direct protein sequencing;Disulfide bond;Protease inhibitor;Serine protease inhibitor |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | PTM: Binds calcium, probably through His-3 to His-6. {ECO:0000269|PubMed:15051044, ECO:0000303|PubMed:15051044}. |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 8,723 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |