| IED ID | IndEnz0002015262 |
| Enzyme Type ID | protease015262 |
| Protein Name |
Bowman-Birk type proteinase inhibitor FBI |
| Gene Name | |
| Organism | Vicia faba (Broad bean) (Faba vulgaris) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids fabids Fabales Fabaceae Papilionoideae 50 kb inversion clade NPAAA clade Hologalegina IRL clade Fabeae Vicia Vicia faba (Broad bean) (Faba vulgaris) |
| Enzyme Sequence | GDDVKSACCDTCLCTKSEPPTCRCVDVGERCHSACNSCVCRYSNPPKCQCFDTHKFCYKSCHN |
| Enzyme Length | 63 |
| Uniprot Accession Number | P24661 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: This inhibitor has two domains, each with separate antiprotease activity. Inhibits bovine trypsin and chymotrypsin, in a molar ratio of 1:1. The trypsin inhibition of FBI is independent of chymotrypsin inhibition, but the chymotrypsin inhibition is not completely independent of trypsin inhibition. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (7); Site (2) |
| Keywords | Direct protein sequencing;Disulfide bond;Protease inhibitor;Serine protease inhibitor |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 6,989 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |