| IED ID | IndEnz0002015263 |
| Enzyme Type ID | protease015263 |
| Protein Name |
Bowman-Birk type proteinase inhibitor VAI |
| Gene Name | |
| Organism | Vicia sativa subsp. nigra (Common vetch) (Vicia angustifolia) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids fabids Fabales Fabaceae Papilionoideae 50 kb inversion clade NPAAA clade Hologalegina IRL clade Fabeae Vicia Vicia sativa (Spring vetch) (Tare) Vicia sativa subsp. nigra (Common vetch) (Vicia angustifolia) |
| Enzyme Sequence | GDDVKSACCDTCLCTRSQPPTCRCVDVGERCHSACNHCVCNYSNPPQCQCFDTHKFCYKACHSSEKEEVIKN |
| Enzyme Length | 72 |
| Uniprot Accession Number | P01065 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: This inhibitor has two domains, each with separate antiprotease activity. 1 mole of inhibitor inhibits either 1 mole of trypsin or 2 moles of chymotrypsin, stoichiometrically. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (7); Site (2) |
| Keywords | Direct protein sequencing;Disulfide bond;Protease inhibitor;Serine protease inhibitor |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 8,038 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |