| IED ID | IndEnz0002015265 |
| Enzyme Type ID | protease015265 |
| Protein Name |
Horsegram inhibitor 1 Bowman-Birk type proteinase inhibitor HGI-I Horsegram inhibitor I Cleaved into: Horsegram germinated inhibitor 1 Horsegram germinated inhibitor I HGGI-I ; Horsegram germinated inhibitor 2 Horsegram germinated inhibitor II HGGI-II ; Horsegram germinated inhibitor 3 Horsegram germinated inhibitor III HGGI-III |
| Gene Name | |
| Organism | Vigna unguiculata subsp. cylindrica (Horse gram) (Dolichos biflorus) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids fabids Fabales Fabaceae Papilionoideae 50 kb inversion clade NPAAA clade indigoferoid/millettioid clade Phaseoleae Vigna Vigna unguiculata (Cowpea) Vigna unguiculata subsp. cylindrica (Horse gram) (Dolichos biflorus) |
| Enzyme Sequence | DHHQSTDEPSESSKPCCDQCTCTKSIPPQCRCTDVRLNSCHSACSSCVCTFSIPAQCVCVDMKDFCYAPCKSSHDD |
| Enzyme Length | 76 |
| Uniprot Accession Number | Q9S9E3 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Inhibitors of trypsin and chymotrypsin. HGGI-III has a higher activity than HGGI-I or HGGI-II. {ECO:0000269|PubMed:12126704, ECO:0000269|Ref.4}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Beta strand (1); Chain (4); Disulfide bond (7); Natural variant (1); Site (2) |
| Keywords | 3D-structure;Direct protein sequencing;Disulfide bond;Protease inhibitor;Serine protease inhibitor |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | PTM: HGGI-I, HGGI-II and HGGI-III are produced by proteolysis of the N- and C-termini of HGI-III. {ECO:0000303|PubMed:12126704, ECO:0000303|Ref.6}. |
| Signal Peptide | |
| Structure 3D | X-ray crystallography (2) |
| Cross Reference PDB | 6E5M; 6EAT; |
| Mapped Pubmed ID | 30817908; |
| Motif | |
| Gene Encoded By | |
| Mass | 8,312 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |