| IED ID | IndEnz0002015281 |
| Enzyme Type ID | protease015281 |
| Protein Name |
Proteinase inhibitor BPI-type |
| Gene Name | |
| Organism | Tachypleus tridentatus (Japanese horseshoe crab) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Protostomia Ecdysozoa Panarthropoda Arthropoda Chelicerata Merostomata (horseshoe crabs) Xiphosura Limulidae Tachypleus Tachypleus tridentatus (Japanese horseshoe crab) |
| Enzyme Sequence | TERGFLDCTSPPVTGPCRAGFKRYNYNTRTKQCEPFKYGGCKGNGNRYKSEQDCLDACSGF |
| Enzyme Length | 61 |
| Uniprot Accession Number | P16044 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Inhibitor of trypsin and chymotrypsin. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (3); Domain (1); Site (1) |
| Keywords | Direct protein sequencing;Disulfide bond;Protease inhibitor;Secreted;Serine protease inhibitor |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 6,825 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |