| IED ID | IndEnz0002015291 |
| Enzyme Type ID | protease015291 |
| Protein Name |
Calpastatin Calpain inhibitor Fragment |
| Gene Name | CAST |
| Organism | Chlorocebus aethiops (Green monkey) (Cercopithecus aethiops) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Primates Haplorrhini Simiiformes Catarrhini Cercopithecoidea Cercopithecidae (Old World monkeys) Cercopithecinae Chlorocebus Chlorocebus aethiops (Green monkey) (Cercopithecus aethiops) |
| Enzyme Sequence | MNPTETKAIPVSQQMEGPHLPNKKKHKKQAVKTEPEKKSQSTKLSVVHEKKSQEGKPKEHTEQKSLPKPASDTGSKDAHNKKAVSRSAEQQPSEKSTEPKTEPQDMVSAGGESVAGVAATSGKPGDKKKEKKSLTPAVPVESKPDKPSGKSGMDAALDDLIDTLGGPEEIEEENTTYTGPEVSDPMSSTYIEELGKREVTIPPKYRELLAKNEGITGPPADSSKPVGPDDAIDALSSDFTCGSPTAAGKKTEKEESTEVLKAQSAGTVRSAAPPQEKKRKVEK |
| Enzyme Length | 283 |
| Uniprot Accession Number | P49342 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Specific inhibition of calpain (calcium-dependent cysteine protease). Plays a key role in postmortem tenderization of meat and have been proposed to be involved in muscle protein degradation in living tissue. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Compositional bias (1); Cross-link (1); Modified residue (6); Non-terminal residue (1); Region (2); Repeat (1) |
| Keywords | Acetylation;Isopeptide bond;Phosphoprotein;Protease inhibitor;Repeat;Thiol protease inhibitor;Ubl conjugation |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | MOD_RES 50; /note=N6-acetyllysine; /evidence=ECO:0000250|UniProtKB:P51125; MOD_RES 87; /note=Phosphoserine; /evidence=ECO:0000250|UniProtKB:P51125; MOD_RES 133; /note=Phosphoserine; /evidence=ECO:0000250|UniProtKB:P20810; MOD_RES 135; /note=Phosphothreonine; /evidence=ECO:0000250|UniProtKB:P27321; MOD_RES 222; /note=Phosphoserine; /evidence=ECO:0000250|UniProtKB:P51125; MOD_RES 243; /note=Phosphoserine; /evidence=ECO:0000250|UniProtKB:P20810 |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 12684003; |
| Motif | |
| Gene Encoded By | |
| Mass | 30,170 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |