IED ID | IndEnz0002015294 |
Enzyme Type ID | protease015294 |
Protein Name |
Calpastatin Calpain inhibitor |
Gene Name | CAST |
Organism | Sus scrofa (Pig) |
Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Laurasiatheria Artiodactyla Suina Suidae (pigs) Sus Sus scrofa (Pig) |
Enzyme Sequence | MNPTETKAIPVSKQLEGPHSPNKKRHKKQAVKTEPEKKSQSTKPSVVHEKKTQEVKPKEHPEPKSLPTHSADAGSKRAHKEKAVSRSNEQPTSEKSTKPKAKPQDPTPSDGKLSVTGVSAASGKPAETKKDDKSLTSSVPAESKSSKPSGKSDMDAALDDLIDTLGGPEETEEDNTTYTGPEVLDPMSSTYIEELGKREVTLPPKYRELLDKKEGIPVPPPDTSKPLGPDDAIDALSLDLTCSSPTADGKKTEKEKSTGEVLKAQSVGVIKSAAAPPHEKKRRVEEDTMSDQALEALSASLGSRKSEPELDLSSIKEIDEAKAKEEKLKKCGEDDETVPPEYRLKPAMDKDGKPLLPEAEEKPKPLSESELIDELSEDFDQSKRKEKQSKPTEKTKESQATAPTPVGEAVSRTSLCCVQSAPPKPATGMVPDDAVEALAGSLGKKEADPEDGKPVEDKVKEKAKEEDREKLGEKEETIPPDYRLEEVKDKDGKTLPHKDPKEPVLPLSEDFVLDALSQDFAGPPAASSLFEDAKLSAAVSEVVSQTSAPTTHSAGPPPDTVSDDKKLDDALDQLSDSLGQRQPDPDENKPIEDKVKEKAEAEHRDKLGERDDTIPPEYRHLLDKDEEGKSTKPPTKKPEAPKKPEAAQDPIDALSGDFDRCPSTTETSENTTKDKDKKTASKSKAPKNGGKAKDSTKAKEETSKQKSDGKSTS |
Enzyme Length | 713 |
Uniprot Accession Number | P12675 |
Absorption | |
Active Site | |
Activity Regulation | |
Binding Site | |
Calcium Binding | |
catalytic Activity | |
DNA Binding | |
EC Number | |
Enzyme Function | FUNCTION: Specific inhibition of calpain (calcium-dependent cysteine protease). Plays a key role in postmortem tenderization of meat and have been proposed to be involved in muscle protein degradation in living tissue. |
Temperature Dependency | |
PH Dependency | |
Pathway | |
nucleotide Binding | |
Features | Chain (1); Compositional bias (9); Cross-link (1); Helix (1); Modified residue (13); Region (3); Repeat (4); Sequence conflict (1) |
Keywords | 3D-structure;Acetylation;Isopeptide bond;Phosphoprotein;Protease inhibitor;Reference proteome;Repeat;Thiol protease inhibitor;Ubl conjugation |
Interact With | |
Induction | |
Subcellular Location | |
Modified Residue | MOD_RES 50; /note=N6-acetyllysine; /evidence=ECO:0000250|UniProtKB:P51125; MOD_RES 87; /note=Phosphoserine; /evidence=ECO:0000250|UniProtKB:P51125; MOD_RES 134; /note=Phosphoserine; /evidence=ECO:0000250|UniProtKB:P20810; MOD_RES 136; /note=Phosphothreonine; /evidence=ECO:0000250|UniProtKB:P27321; MOD_RES 244; /note=Phosphoserine; /evidence=ECO:0000250|UniProtKB:P20810; MOD_RES 367; /note=Phosphoserine; /evidence=ECO:0000250|UniProtKB:P20810; MOD_RES 369; /note=Phosphoserine; /evidence=ECO:0000250|UniProtKB:P20810; MOD_RES 376; /note=Phosphoserine; /evidence=ECO:0000250|UniProtKB:P20810; MOD_RES 441; /note=Phosphoserine; /evidence=ECO:0000250|UniProtKB:P20810; MOD_RES 517; /note=Phosphoserine; /evidence=ECO:0000250|UniProtKB:P20810; MOD_RES 528; /note=Phosphoserine; /evidence=ECO:0000250|UniProtKB:P20810; MOD_RES 575; /note=Phosphoserine; /evidence=ECO:0000250|UniProtKB:P20810; MOD_RES 577; /note=Phosphoserine; /evidence=ECO:0000250|UniProtKB:P20810 |
Post Translational Modification | |
Signal Peptide | |
Structure 3D | X-ray crystallography (2) |
Cross Reference PDB | 1NX0; 1NX1; |
Mapped Pubmed ID | 12684003; |
Motif | |
Gene Encoded By | |
Mass | 77,124 |
Kinetics | |
Metal Binding | |
Rhea ID | |
Cross Reference Brenda |