| IED ID | IndEnz0002015307 |
| Enzyme Type ID | protease015307 |
| Protein Name |
Subtilisin inhibitor CLSI-II Cleaved into: Subtilisin inhibitor CLSI-III |
| Gene Name | |
| Organism | Canavalia lineata (Beach bean) (Dolichos lineatus) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids fabids Fabales Fabaceae Papilionoideae 50 kb inversion clade NPAAA clade indigoferoid/millettioid clade Phaseoleae Canavalia Canavalia lineata (Beach bean) (Dolichos lineatus) |
| Enzyme Sequence | NDVDVVMDASSKPIFPGGEYYIMPAIWGPPGGGVRLAKTRNSDCPVTVLQDYGEVIFGQPVKFTLPGRGSGLIITNTPVEEFIKKPECASSSKWSVFVDDEIEKACVGIGGHEDHPGEQVFSGTFTIQKSRTPYNSYKLVFCESDSSTCSDIGRYDNNEGGRRLILTHHNPFQVVFMDASTFDGTIRSDG |
| Enzyme Length | 190 |
| Uniprot Accession Number | P81726 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Inhibits subtilisin-type microbial serine proteases incuding proteinase K, subtilisin BPN', subtilisin Carlsberg and subtilisin E in a non-stoichiometric manner. Weakly inhibits A.oryzae protease and some metalloproteases including pronase E. Does not inhibit trypsin, chymotrypsin, S.griseus alkaline protease or A.lyticus lysyl endopeptidase. CLSI-II has a wider inhibitory specificity than CLSI-III. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (2); Disulfide bond (3); Natural variant (1); Site (1) |
| Keywords | Direct protein sequencing;Disulfide bond;Protease inhibitor;Secreted;Serine protease inhibitor |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted. |
| Modified Residue | |
| Post Translational Modification | PTM: The N-terminal Asn is removed in about 50% of both the CLSI-II and CLSI-III chains. |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 20,750 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |