| IED ID | IndEnz0002015308 |
| Enzyme Type ID | protease015308 |
| Protein Name |
Subtilisin-chymotrypsin inhibitor-2A CI-2A |
| Gene Name | |
| Organism | Hordeum vulgare (Barley) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae Liliopsida Petrosaviidae commelinids Poales Poaceae BOP clade Pooideae Triticodae Triticeae Hordeinae Hordeum Hordeum vulgare (Barley) |
| Enzyme Sequence | MSSVEKKPEGVNTGAGDRHNLKTEWPELVGKSVEEAKKVILQDKPEAQIIVLPVGTIVTMEYRIDRVRLFVDKLDNIAQVPRVG |
| Enzyme Length | 84 |
| Uniprot Accession Number | P01053 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Inhibits both subtilisin and chymotrypsin. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Beta strand (4); Chain (1); Helix (2); Initiator methionine (1); Region (1); Sequence conflict (1); Site (1) |
| Keywords | 3D-structure;Direct protein sequencing;Protease inhibitor;Serine protease inhibitor |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | NMR spectroscopy (3); X-ray crystallography (17) |
| Cross Reference PDB | 1CIQ; 1CIR; 1CIS; 1COA; 1CQ4; 1LW6; 1YPA; 1YPB; 1YPC; 2CI2; 2SNI; 3CI2; 5FBZ; 5FFN; 6QIY; 6QIZ; 7A1H; 7A3M; 7AOK; 7AON; |
| Mapped Pubmed ID | 12142461; 3064813; 31836707; 34408246; 8218165; 8218191; 9990011; |
| Motif | |
| Gene Encoded By | |
| Mass | 9,381 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |