| IED ID | IndEnz0002015309 |
| Enzyme Type ID | protease015309 |
| Protein Name |
Subtilisin-chymotrypsin inhibitor-2B CI-2B Fragment |
| Gene Name | |
| Organism | Hordeum vulgare (Barley) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae Liliopsida Petrosaviidae commelinids Poales Poaceae BOP clade Pooideae Triticodae Triticeae Hordeinae Hordeum Hordeum vulgare (Barley) |
| Enzyme Sequence | DCLCDCQNQKTEWPELVEKSVEEAKKVILQDKPEAQIIVLPVGTIVTMEYRIDRVRLFVDRLDNIAQVPRVG |
| Enzyme Length | 72 |
| Uniprot Accession Number | P08626 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Inhibits both subtilisin and chymotrypsin. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Non-terminal residue (1); Site (1) |
| Keywords | Protease inhibitor;Serine protease inhibitor |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 8,296 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |