| IED ID |
IndEnz0002015311 |
| Enzyme Type ID |
protease015311 |
| Protein Name |
Chymotrypsin inhibitor I, A, B and C subunits
|
| Gene Name |
|
| Organism |
Solanum tuberosum (Potato) |
| Taxonomic Lineage |
cellular organisms
Eukaryota
Viridiplantae
Streptophyta
Streptophytina
Embryophyta
Tracheophyta
Euphyllophyta
Spermatophyta
Magnoliopsida
Mesangiospermae
eudicotyledons
Gunneridae
Pentapetalae
asterids
lamiids
Solanales
Solanaceae
Solanoideae
Solaneae
Solanum
Solanum tuberosum (Potato)
|
| Enzyme Sequence |
KEFECDGKLQWPELIGVPTKLAKEIIEKQNSLISNVHILLNGSPVTMDFRCNRVRLFDDILGSVVQIPRVA |
| Enzyme Length |
71 |
| Uniprot Accession Number |
P01052 |
| Absorption |
|
| Active Site |
|
| Activity Regulation |
|
| Binding Site |
|
| Calcium Binding |
|
| catalytic Activity |
|
| DNA Binding |
|
| EC Number |
|
| Enzyme Function |
FUNCTION: Inhibits both chymotrypsin and trypsin. |
| Temperature Dependency |
|
| PH Dependency |
|
| Pathway |
|
| nucleotide Binding |
|
| Features |
Chain (1); Natural variant (10); Site (1) |
| Keywords |
Direct protein sequencing;Protease inhibitor;Reference proteome;Serine protease inhibitor |
| Interact With |
|
| Induction |
|
| Subcellular Location |
|
| Modified Residue |
|
| Post Translational Modification |
|
| Signal Peptide |
|
| Structure 3D |
|
| Cross Reference PDB |
- |
| Mapped Pubmed ID |
- |
| Motif |
|
| Gene Encoded By |
|
| Mass |
8,033 |
| Kinetics |
|
| Metal Binding |
|
| Rhea ID |
|
| Cross Reference Brenda |
|