| IED ID | IndEnz0002015312 |
| Enzyme Type ID | protease015312 |
| Protein Name |
Immunoglobulin heavy variable 3-30 Ig heavy chain V-III region BUR Ig heavy chain V-III region CAM Ig heavy chain V-III region GA Ig heavy chain V-III region NIE |
| Gene Name | IGHV3-30 |
| Organism | Homo sapiens (Human) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Primates Haplorrhini Simiiformes Catarrhini Hominoidea (apes) Hominidae (great apes) Homininae Homo Homo sapiens (Human) |
| Enzyme Sequence | MEFGLSWVFLVALLRGVQCQVQLVESGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAVISYDGSNKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAK |
| Enzyme Length | 117 |
| Uniprot Accession Number | P01768 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: V region of the variable domain of immunoglobulin heavy chains that participates in the antigen recognition (PubMed:24600447). Immunoglobulins, also known as antibodies, are membrane-bound or secreted glycoproteins produced by B lymphocytes. In the recognition phase of humoral immunity, the membrane-bound immunoglobulins serve as receptors which, upon binding of a specific antigen, trigger the clonal expansion and differentiation of B lymphocytes into immunoglobulins-secreting plasma cells. Secreted immunoglobulins mediate the effector phase of humoral immunity, which results in the elimination of bound antigens (PubMed:22158414, PubMed:20176268). The antigen binding site is formed by the variable domain of one heavy chain, together with that of its associated light chain. Thus, each immunoglobulin has two antigen binding sites with remarkable affinity for a particular antigen. The variable domains are assembled by a process called V-(D)-J rearrangement and can then be subjected to somatic hypermutations which, after exposure to antigen and selection, allow affinity maturation for a particular antigen (PubMed:20176268, PubMed:17576170). {ECO:0000303|PubMed:17576170, ECO:0000303|PubMed:20176268, ECO:0000303|PubMed:22158414, ECO:0000303|PubMed:24600447}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (1); Domain (1); Modified residue (1); Non-terminal residue (1); Sequence conflict (39); Signal peptide (1) |
| Keywords | Adaptive immunity;Cell membrane;Direct protein sequencing;Disulfide bond;Immunity;Immunoglobulin;Immunoglobulin domain;Membrane;Pyrrolidone carboxylic acid;Reference proteome;Secreted;Signal |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000303|PubMed:20176268, ECO:0000303|PubMed:22158414}. Cell membrane {ECO:0000303|PubMed:20176268, ECO:0000303|PubMed:22158414}. |
| Modified Residue | MOD_RES 20; /note="Pyrrolidone carboxylic acid"; /evidence="ECO:0000269|PubMed:107164, ECO:0000269|PubMed:4208843, ECO:0000269|PubMed:6774332, ECO:0000269|PubMed:826475" |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..19; /evidence="ECO:0000269|PubMed:107164, ECO:0000269|PubMed:4208843, ECO:0000269|PubMed:6774332, ECO:0000269|PubMed:826475" |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 10026222; 10051622; 10072481; 10498607; 10523831; 10556826; 10579907; 10648173; 1081164; 10861086; 10917520; 10925294; 10931839; 11071869; 11226282; 11368773; 11425868; 11449366; 11507089; 11606584; 11713268; 11779189; 11854399; 11877257; 11909947; 11955599; 11994425; 12089510; 12117970; 12181444; 12217391; 12396008; 12417718; 12453414; 12456653; 12473184; 1249422; 12573241; 12660731; 12670955; 12869549; 1314888; 1372004; 1374290; 1375264; 1376928; 14280442; 14630197; 15010370; 1506682; 15161916; 15184383; 15199963; 1550550; 15509800; 15536084; 15686303; 1569953; 15809313; 15879134; 1599430; 16456001; 16546099; 16849466; 16921024; 16938345; 16978534; 1702903; 1705565; 1707541; 1714601; 17308335; 17498065; 17993265; 18006696; 18052078; 18070890; 18818202; 19206206; 19372136; 19592646; 2011584; 20192804; 20807769; 21037092; 21469132; 21822214; 2303036; 2304550; 23593269; 23675550; 23836650; 2474607; 25200415; 2529342; 3500860; 4589993; 6019133; 6335036; 70787; 7512959; 7516890; 7517665; 7518558; 7521687; 7522622; 7524079; 7526393; 7528327; 7530449; 7538118; 7561031; 7565679; 7592958; 7594458; 760802; 7608543; 761607; 7618087; 7681402; 7688784; 7706301; 7718892; 7927516; 803528; 8071371; 814163; 8163536; 8166770; 8226994; 8306975; 8327478; 8340414; 8475064; 8541526; 8611682; 8629002; 8630736; 8657103; 8663278; 8702662; 8809042; 8862523; 8910399; 8947047; 8986718; 8995445; 9000504; 9042338; 9050880; 9188445; 9199344; 9295361; 9314552; 9326643; 9341187; 9480991; 9547345; 9601638; 9697839; 9705962; 9857068; 9885284; 9890995; |
| Motif | |
| Gene Encoded By | |
| Mass | 12,947 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |