| IED ID | IndEnz0002015316 |
| Enzyme Type ID | protease015316 |
| Protein Name |
Wound-induced proteinase inhibitor 1 Chymotrypsin inhibitor I, D subunit Wound-induced proteinase inhibitor I |
| Gene Name | |
| Organism | Solanum tuberosum (Potato) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae asterids lamiids Solanales Solanaceae Solanoideae Solaneae Solanum Solanum tuberosum (Potato) |
| Enzyme Sequence | MESKFAHIIVFFLLATSFETLLARKESDGPEVIELQKEFECNGKQRWPELIGVPTKLAKGIIEKENSLITNVQILLNGSPVTMDYRCNRVRLFDNILGDVVQIPRVA |
| Enzyme Length | 107 |
| Uniprot Accession Number | P08454 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Inhibits both chymotrypsin and trypsin. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Propeptide (1); Sequence conflict (3); Signal peptide (1); Site (1) |
| Keywords | Direct protein sequencing;Protease inhibitor;Reference proteome;Serine protease inhibitor;Signal |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..23 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 12,145 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |