| IED ID | IndEnz0002015317 |
| Enzyme Type ID | protease015317 |
| Protein Name |
Subtilisin inhibitor Fragment |
| Gene Name | |
| Organism | Vicia faba (Broad bean) (Faba vulgaris) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids fabids Fabales Fabaceae Papilionoideae 50 kb inversion clade NPAAA clade Hologalegina IRL clade Fabeae Vicia Vicia faba (Broad bean) (Faba vulgaris) |
| Enzyme Sequence | RTSWPELVGVSAEEARKIKEEMPEAEIQVVPQDSFVTADYKFQRVRLYVDESNKVVRAAPIG |
| Enzyme Length | 62 |
| Uniprot Accession Number | P08820 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Inhibits subtilisin and more weakly elastase. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Natural variant (2); Non-terminal residue (1); Site (1) |
| Keywords | Direct protein sequencing;Protease inhibitor;Serine protease inhibitor |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 7,064 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |