| IED ID | IndEnz0002015318 |
| Enzyme Type ID | protease015318 |
| Protein Name |
Chymotrypsin inhibitor WCI Chloroform/methanol-soluble protein WCI |
| Gene Name | |
| Organism | Triticum aestivum (Wheat) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae Liliopsida Petrosaviidae commelinids Poales Poaceae BOP clade Pooideae Triticodae Triticeae Triticinae Triticum Triticum aestivum (Wheat) |
| Enzyme Sequence | TSIYTCYEGVGLPVDPLQGCHYYVTSQTCGFVPLLPIEVMKDRCCRELAAISSNCRCEGLRVFIDRAFPPSQSQGGGPPQPPLAPRCPTEVKRDFARTLALPGQCNLPTIHGGPYCVFP |
| Enzyme Length | 119 |
| Uniprot Accession Number | P83207 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Inhibits bovine, insect and wheat chymotrypsins. Inhibits bovine chymotrypsin with Ki of 0.6 nM. Does not inhibit human or wheat alpha-amylases, bovine pancreatic trypsin, or trypsin-like activity isolated from wheat. {ECO:0000269|PubMed:21617989}. |
| Temperature Dependency | BIOPHYSICOCHEMICAL PROPERTIES: Temperature dependence: Optimum temperature is 25 degrees Celsius. {ECO:0000269|PubMed:21617989}; |
| PH Dependency | BIOPHYSICOCHEMICAL PROPERTIES: pH dependence: Optimum pH range is 7.0-9.0. {ECO:0000269|PubMed:21617989}; |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (5); Natural variant (1) |
| Keywords | Direct protein sequencing;Disulfide bond;Protease inhibitor;Reference proteome;Secreted;Serine protease inhibitor |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000250|UniProtKB:P01087}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 12,944 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |