Detail Information for IndEnz0002015329
IED ID IndEnz0002015329
Enzyme Type ID protease015329
Protein Name Indian hedgehog protein
IHH
Fragment
Gene Name ihh
Organism Danio albolineatus pulcher (Blue-redstripe danio)
Taxonomic Lineage cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Actinopterygii Actinopteri Neopterygii Teleostei Osteoglossocephalai Clupeocephala Otomorpha Ostariophysi Otophysi Cypriniphysae Cypriniformes (carps and others) Cyprinoidei Danionidae Danioninae Danio Danio albolineatus pulcher (Blue-redstripe danio)
Enzyme Sequence VMNLWPGVRLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRNKYAMLARLAVEAGF
Enzyme Length 58
Uniprot Accession Number P79719
Absorption
Active Site
Activity Regulation
Binding Site
Calcium Binding
catalytic Activity
DNA Binding
EC Number
Enzyme Function FUNCTION: Intercellular signal essential for a variety of patterning events during development. {ECO:0000250}.
Temperature Dependency
PH Dependency
Pathway
nucleotide Binding
Features Chain (1); Metal binding (7); Non-terminal residue (2)
Keywords Autocatalytic cleavage;Calcium;Cell membrane;Developmental protein;Hydrolase;Lipoprotein;Membrane;Metal-binding;Palmitate;Protease;Secreted;Zinc
Interact With
Induction
Subcellular Location SUBCELLULAR LOCATION: Cell membrane {ECO:0000250}. Secreted, extracellular space {ECO:0000250}. Note=Indian hedgehog protein N-product: Cell membrane; Lipid-anchor; Extracellular side. The N-terminal peptide remains associated with the cell surface. Indian hedgehog protein C-product: Secreted, extracellular space. The C-terminal peptide diffuses from the cell. {ECO:0000250}.
Modified Residue
Post Translational Modification PTM: The C-terminal domain displays an autoproteolysis activity and a cholesterol transferase activity. Both activities result in the cleavage of the full-length protein and covalent attachment of a cholesterol moiety to the C-terminal of the newly generated N-terminal fragment (N-product). The N-product is the active species in both local and long-range signaling, whereas the C-product has no signaling activity (By similarity). {ECO:0000250}.; PTM: Cholesterylation is required for N-product targeting to lipid rafts and multimerization. {ECO:0000250}.; PTM: N-palmitoylation is required for N-product multimerization and full activity. {ECO:0000250}.
Signal Peptide
Structure 3D
Cross Reference PDB -
Mapped Pubmed ID -
Motif
Gene Encoded By
Mass 6,658
Kinetics
Metal Binding METAL 13; /note=Calcium 1; via carbonyl oxygen; /evidence=ECO:0000250|UniProtKB:Q14623; METAL 14; /note=Calcium 1; /evidence=ECO:0000250|UniProtKB:Q14623; METAL 14; /note=Calcium 2; /evidence=ECO:0000250|UniProtKB:Q14623; METAL 17; /note=Calcium 2; /evidence=ECO:0000250|UniProtKB:Q14623; METAL 19; /note=Calcium 2; /evidence=ECO:0000250|UniProtKB:Q14623; METAL 28; /note=Zinc; /evidence=ECO:0000250|UniProtKB:Q14623; METAL 35; /note=Zinc; /evidence=ECO:0000250|UniProtKB:Q14623
Rhea ID
Cross Reference Brenda