| IED ID | IndEnz0002015345 |
| Enzyme Type ID | protease015345 |
| Protein Name |
Amoebiasin-1 Cysteine protease inhibitor 1 EhICP1 ICP-1 |
| Gene Name | AMS ICP1 |
| Organism | Entamoeba histolytica |
| Taxonomic Lineage | cellular organisms Eukaryota Amoebozoa Evosea Archamoebae Mastigamoebida Entamoebidae Entamoeba Entamoeba histolytica |
| Enzyme Sequence | MSLTEDNNNTTITIAKGENKEIILHGNPTTGYSWVVDSCEGLSNTVEYVADQHAPGICGCGGKYHIKITGTQTGEGKIVLVYRRPWAPNANDRTFTLKVNVQ |
| Enzyme Length | 102 |
| Uniprot Accession Number | Q6KCA4 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: May serve to protect the cytosol against cysteine protease molecules released by damaged intracellular vesicles. Inhibits papain and soluble trophozoite extract. {ECO:0000269|PubMed:15757643}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Beta strand (7); Chain (1); Helix (1); Motif (1); Turn (1) |
| Keywords | 3D-structure;Cytoplasm;Protease inhibitor;Thiol protease inhibitor |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000269|PubMed:15757643}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | NMR spectroscopy (1) |
| Cross Reference PDB | 6CJZ; |
| Mapped Pubmed ID | 32731033; |
| Motif | MOTIF 27..31; /note=NPTTG motif |
| Gene Encoded By | |
| Mass | 11,123 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |