| IED ID | IndEnz0002015348 |
| Enzyme Type ID | protease015348 |
| Protein Name |
Securin-like protein Interactor of Fizzy protein |
| Gene Name | ify-1 C27A2.3 |
| Organism | Caenorhabditis elegans |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Protostomia Ecdysozoa Nematoda (roundworms) Chromadorea Rhabditida Rhabditina Rhabditomorpha Rhabditoidea Rhabditidae Peloderinae Caenorhabditis Caenorhabditis elegans |
| Enzyme Sequence | MEDLNFEERGSTQIPASLQQHFSAKLGRQNELEKTPSRGGLGLVVNSSKTPGGKSLQSLASACKVPPSTKKNTIPIAFECYEDETDDQIADVATIKKTEKHPCSPIDTANRCETFDSLAADIEDDMLNLEDQDVVLSEDRPYGDVIDPAESEAEALAELGVEEWDSYPPIDPASRIGDDFNYVLRTEDFAEEGDVKLEETRHRTVIADIDEVKMSKAERNELFSMLADDLDSYDLLAEEANLPL |
| Enzyme Length | 244 |
| Uniprot Accession Number | Q18235 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Acts as a chaperone and as an inhibitor for separase sep-1 (PubMed:27249343, PubMed:28263324). Plays an essential role in maintaining chromosome cohesion prior to meiotic and mitotic anaphase, in cytokinesis and in organizing the spindle and the centrosome (PubMed:12498686). Ubiquitination-dependent degradation at the onset of anaphase is likely to activate sep-1 resulting in the proteolysis of the cohesin complex and the subsequent segregation of the chromosomes (PubMed:12498686, PubMed:23578927). Also required for cortical granule exocytosis (PubMed:17913784). {ECO:0000269|PubMed:12498686, ECO:0000269|PubMed:17913784, ECO:0000269|PubMed:23578927}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Region (1) |
| Keywords | 3D-structure;Cell cycle;Cell division;Chromosome;Cytoplasm;Cytoskeleton;Meiosis;Mitosis;Reference proteome;Ubl conjugation |
| Interact With | G5ED39 |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000269|PubMed:23578927}. Chromosome {ECO:0000269|PubMed:23578927}. Cytoplasm, cytoskeleton, spindle {ECO:0000269|PubMed:23578927}. Note=Localizes to cytoplasm in germ cells. After oocyte nuclear envelope breakdown, localizes to chromosomes and spindle microtubules until meiotic anaphase I where the chromosome localization disappears. Maintained at low levels in the cytoplasm during meiosis II and in subsequent mitotic divisions during early embryogenesis. Localizes to chromosomes during mitotic metaphase at the 4E embryonic stage. {ECO:0000269|PubMed:23578927}. |
| Modified Residue | |
| Post Translational Modification | PTM: Ubiquitinated by etc-1 likely at the onset of anaphase, resulting in its degradation. {ECO:0000269|PubMed:23578927}. |
| Signal Peptide | |
| Structure 3D | Electron microscopy (1) |
| Cross Reference PDB | 5MZ6; |
| Mapped Pubmed ID | 12242227; 12445391; 12529635; 14551910; 14704431; 15489339; 15791247; 17417969; 17704769; 20308279; 21177967; 21529718; 22560298; 22901814; 23800452; 25487147; |
| Motif | |
| Gene Encoded By | |
| Mass | 27,002 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |