IED ID | IndEnz0002015352 |
Enzyme Type ID | protease015352 |
Protein Name |
Core protease I7 EC 3.4.22.- |
Gene Name | I7L |
Organism | Vaccinia virus (strain Copenhagen) (VACV) |
Taxonomic Lineage | Viruses Varidnaviria Bamfordvirae Nucleocytoviricota Pokkesviricetes Chitovirales Poxviridae Chordopoxvirinae Orthopoxvirus Vaccinia virus Vaccinia virus (strain Copenhagen) (VACV) |
Enzyme Sequence | MERYTDLVISKIPELGFTNLLCHIYSLAGLCSNIDVSKFLTNCNGYVVEKYDKSTTAGKVSCIPIGMMLELVESGHLSRPNSSDELDQKKELTDELKTRYHSIYDVFELPTSIPLAYFFKPRLREKVSKAIDFSQMDLKIDDLSRKGIHTGENPKVVKMKIEPERGAWMSNRSIKNLVSQFAYGSEVDYIGQFDMRFLNSLAIHEKFDAFMNKHILSYILKDKIKSSTSRFVMFGFCYLSHWKCVIYDKKQCLVSFYDSGGNIPTEFHHYNNFYFYSFSDGFNTNHRHSVLDNTNCDIDVLFRFFECTFGAKIGCINVEVNQLLESECGMFISLFMILCTRTPPKSFKSLKKVYTFFKFLADKKMTLFKSILFNLHDLSLDITETDNAGLKEYKRMEKWTKKSINVICDKLTTKLNRIVDDDE |
Enzyme Length | 423 |
Uniprot Accession Number | P20501 |
Absorption | |
Active Site | ACT_SITE 241; /evidence=ECO:0000250; ACT_SITE 248; /evidence=ECO:0000250; ACT_SITE 328; /evidence=ECO:0000250 |
Activity Regulation | |
Binding Site | |
Calcium Binding | |
catalytic Activity | |
DNA Binding | |
EC Number | 3.4.22.- |
Enzyme Function | FUNCTION: Late protein responsible for processing most or all of the viral core and membrane proteins known to undergo morphogenesis-associated proteolysis. These proteolytic events are involved in the transformation of immature virions (IV) into mature virions (MV). Probably cleaves at least the A3, A10, L4, and A17 precursors preferentially at Ala-Gly-|-Ala motifs. Also seems to process Ala-Gly-|-Ser and Ala-Gly-|-Thr motifs (By similarity). {ECO:0000250}. |
Temperature Dependency | |
PH Dependency | |
Pathway | |
nucleotide Binding | |
Features | Active site (3); Chain (1) |
Keywords | Hydrolase;Late protein;Protease;Reference proteome;Thiol protease;Virion |
Interact With | |
Induction | INDUCTION: Expressed late in the viral replicative cycle. |
Subcellular Location | SUBCELLULAR LOCATION: Virion {ECO:0000250}. Note=Present in the virion core. {ECO:0000250}. |
Modified Residue | |
Post Translational Modification | |
Signal Peptide | |
Structure 3D | |
Cross Reference PDB | - |
Mapped Pubmed ID | - |
Motif | |
Gene Encoded By | |
Mass | 49,040 |
Kinetics | |
Metal Binding | |
Rhea ID | |
Cross Reference Brenda |