| IED ID | IndEnz0002015367 |
| Enzyme Type ID | protease015367 |
| Protein Name |
Alpha-amylase inhibitor BMAI-1 Alpha-amylase flour inhibitor allergen Hor v 1 Fragment |
| Gene Name | IAM1 |
| Organism | Hordeum vulgare (Barley) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae Liliopsida Petrosaviidae commelinids Poales Poaceae BOP clade Pooideae Triticodae Triticeae Hordeinae Hordeum Hordeum vulgare (Barley) |
| Enzyme Sequence | PTSVAVDQGSMVSNSPGEWCWPGMGYPVYPFPRCRALVKSQCAGGQVVESIQKDCCRQIAAIGDEWCICGALGSMRGSMYKELGVALADDKATVAEVFPGCRTEVMDRAVASLPAVCNQYIPNTNGTDGVCYWLSYYQPPRQMSSR |
| Enzyme Length | 146 |
| Uniprot Accession Number | P16968 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Could be involved in insect defense mechanisms. Inhibits insect-type alpha-amylase. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Glycosylation (1); Non-terminal residue (1); Signal peptide (1) |
| Keywords | Allergen;Alpha-amylase inhibitor;Direct protein sequencing;Disulfide bond;Glycoprotein;Secreted;Signal |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted. |
| Modified Residue | |
| Post Translational Modification | PTM: Five disulfide bonds are present (Probable), which are essential for the inhibitor activity.; PTM: Glycosylated. |
| Signal Peptide | SIGNAL <1..14; /evidence=ECO:0000269|PubMed:2785932 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 15,816 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |