| IED ID | IndEnz0002015368 |
| Enzyme Type ID | protease015368 |
| Protein Name |
Alpha-amylase inhibitor 0.19 0.19 alpha-AI 0.19 AI allergen Tri a 28 |
| Gene Name | |
| Organism | Triticum aestivum (Wheat) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae Liliopsida Petrosaviidae commelinids Poales Poaceae BOP clade Pooideae Triticodae Triticeae Triticinae Triticum Triticum aestivum (Wheat) |
| Enzyme Sequence | SGPWMCYPGQAFQVPALPACRPLLRLQCNGSQVPEAVLRDCCQQLAHISEWCRCGALYSMLDSMYKEHGAQEGQAGTGAFPRCRREVVKLTAASITAVCRLPIVVDASGDGAYVCKDVAAYPDA |
| Enzyme Length | 124 |
| Uniprot Accession Number | P01085 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Alpha-amylase inhibitor. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Beta strand (1); Chain (1); Disulfide bond (5); Helix (6); Turn (4) |
| Keywords | 3D-structure;Allergen;Alpha-amylase inhibitor;Direct protein sequencing;Disulfide bond;Reference proteome;Secreted |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted. |
| Modified Residue | |
| Post Translational Modification | PTM: The disulfide bonds are essential for the inhibitor activity. |
| Signal Peptide | |
| Structure 3D | X-ray crystallography (1) |
| Cross Reference PDB | 1HSS; |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 13,337 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |