| IED ID |
IndEnz0002015389 |
| Enzyme Type ID |
protease015389 |
| Protein Name |
Cystatin
|
| Gene Name |
|
| Organism |
Bitis arietans (African puff adder) |
| Taxonomic Lineage |
cellular organisms
Eukaryota
Opisthokonta
Metazoa
Eumetazoa
Bilateria
Deuterostomia
Chordata
Craniata
Vertebrata
Gnathostomata (jawed vertebrates)
Teleostomi
Euteleostomi
Sarcopterygii
Dipnotetrapodomorpha
Tetrapoda
Amniota
Sauropsida
Sauria (diapsids)
Lepidosauria (lepidosaurs)
Squamata (squamates)
Bifurcata (split-tongued squamates)
Unidentata
Episquamata
Toxicofera
Serpentes (snakes)
Colubroidea
Viperidae
Viperinae (vipers)
Bitis
Bitis arietans (African puff adder)
|
| Enzyme Sequence |
IPGGLSPRDVTDPDVQEAAAFAVEKYNAGSKNDYYFKERRVVEAQSQVVSGVKYYLMMELLKTTCKKTVGRPKGYQEIQNCNLPPENQQEEITCRFEVWSRPWLPSTSLTK |
| Enzyme Length |
111 |
| Uniprot Accession Number |
P08935 |
| Absorption |
|
| Active Site |
|
| Activity Regulation |
|
| Binding Site |
|
| Calcium Binding |
|
| catalytic Activity |
|
| DNA Binding |
|
| EC Number |
|
| Enzyme Function |
FUNCTION: Inhibits various C1 cysteine proteases including cathepsin L, papain and cathepsin B. This protein has no toxic activity and its function in the venom is unknown. It may play a role as housekeeping or regulatory protein (By similarity). {ECO:0000250}. |
| Temperature Dependency |
|
| PH Dependency |
|
| Pathway |
|
| nucleotide Binding |
|
| Features |
Chain (1); Disulfide bond (1); Domain (1); Motif (1); Natural variant (1); Site (1) |
| Keywords |
Direct protein sequencing;Disulfide bond;Protease inhibitor;Secreted;Thiol protease inhibitor |
| Interact With |
|
| Induction |
|
| Subcellular Location |
SUBCELLULAR LOCATION: Secreted. |
| Modified Residue |
|
| Post Translational Modification |
|
| Signal Peptide |
|
| Structure 3D |
|
| Cross Reference PDB |
- |
| Mapped Pubmed ID |
- |
| Motif |
MOTIF 47..51; /note=Secondary area of contact |
| Gene Encoded By |
|
| Mass |
12,678 |
| Kinetics |
|
| Metal Binding |
|
| Rhea ID |
|
| Cross Reference Brenda |
|