| IED ID | IndEnz0002015390 |
| Enzyme Type ID | protease015390 |
| Protein Name |
Bitiscystatin Cystatin |
| Gene Name | |
| Organism | Bitis gabonica (Gaboon adder) (Gaboon viper) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Sauropsida Sauria (diapsids) Lepidosauria (lepidosaurs) Squamata (squamates) Bifurcata (split-tongued squamates) Unidentata Episquamata Toxicofera Serpentes (snakes) Colubroidea Viperidae Viperinae (vipers) Bitis Bitis gabonica (Gaboon adder) (Gaboon viper) |
| Enzyme Sequence | MHSRLLVAAPHCLLLLLLLPSALPALKVGGLYPRDVMDPEVQEAAAFAVENYNAQSTNDNYFKARRIVEAQSQVVSGVKYYLKMELAKTTCKKIAGKPKLYQEIQNCNLPPENQQEEITCHFEVWSRPWLQKTVLTKDEL |
| Enzyme Length | 140 |
| Uniprot Accession Number | Q6T6T4 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Inhibits various C1 cysteine proteases including cathepsin L, papain and cathepsin B. This protein has no toxic activity and its function in the venom is unknown. It may play a role as housekeeping or regulatory protein (By similarity). {ECO:0000250}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (1); Domain (1); Motif (1); Signal peptide (1); Site (1) |
| Keywords | Direct protein sequencing;Disulfide bond;Protease inhibitor;Secreted;Signal;Thiol protease inhibitor |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000269|PubMed:17203976}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..26; /evidence=ECO:0000269|PubMed:17203976 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | MOTIF 73..77; /note=Secondary area of contact |
| Gene Encoded By | |
| Mass | 15,900 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |