Detail Information for IndEnz0002015410
IED ID IndEnz0002015410
Enzyme Type ID protease015410
Protein Name Hirudin variant-1
Hirudin-1
Hirudin-I
Lepirudin
Gene Name
Organism Hirudo medicinalis (Medicinal leech)
Taxonomic Lineage cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Protostomia Spiralia Lophotrochozoa Annelida Clitellata Hirudinea (leeches) Hirudinida Hirudiniformes Hirudinidae Hirudo Hirudo medicinalis (Medicinal leech)
Enzyme Sequence VVYTDCTESGQNLCLCEGSNVCGQGNKCILGSDGEKNQCVTGEGTPKPQSHNDGDFEEIPEEYLQ
Enzyme Length 65
Uniprot Accession Number P01050
Absorption
Active Site
Activity Regulation
Binding Site
Calcium Binding
catalytic Activity
DNA Binding
EC Number
Enzyme Function FUNCTION: Hirudin is a potent thrombin-specific protease inhibitor. It forms a stable non-covalent complex with alpha-thrombin, thereby abolishing its ability to cleave fibrinogen. {ECO:0000269|PubMed:17585879}.
Temperature Dependency
PH Dependency
Pathway
nucleotide Binding
Features Beta strand (6); Chain (1); Disulfide bond (3); Glycosylation (1); Helix (1); Modified residue (1); Mutagenesis (19); Region (3)
Keywords 3D-structure;Direct protein sequencing;Disulfide bond;Glycoprotein;Pharmaceutical;Protease inhibitor;Secreted;Serine protease inhibitor;Sulfation
Interact With
Induction
Subcellular Location SUBCELLULAR LOCATION: Secreted.
Modified Residue MOD_RES 63; /note="Sulfotyrosine"; /evidence="ECO:0000269|PubMed:17685615, ECO:0000269|PubMed:8251938"
Post Translational Modification
Signal Peptide
Structure 3D NMR spectroscopy (6); X-ray crystallography (68)
Cross Reference PDB 1AD8; 1AE8; 1AFE; 1AHT; 1AI8; 1AWF; 1AY6; 1BA8; 1BB0; 1BCU; 1CA8; 1D3D; 1D3P; 1D3Q; 1D3T; 1D4P; 1H8D; 1H8I; 1HIC; 1HRT; 1HXE; 1HXF; 1NO9; 1QHR; 1QJ1; 1QJ6; 1QJ7; 1TMT; 1TMU; 1UMA; 1WBG; 2HIR; 2JOO; 2PW8; 2UUF; 2UUJ; 2UUK; 2V3O; 2ZC9; 2ZDA; 2ZDV; 2ZF0; 2ZFF; 2ZFP; 2ZGB; 2ZGX; 2ZHQ; 2ZI2; 2ZIQ; 2ZNK; 2ZO3; 3D49; 3DHK; 3DT0; 3DUX; 3EGK; 3EQ0; 3LDX; 3UTU; 4AX9; 4BAH; 4BAK; 4BAM; 4BAN; 4BAQ; 4HIR; 4LXB; 4MLF; 4YES; 5HIR; 6HIR; 7A0D; 7A0E; 7A0F;
Mapped Pubmed ID 10387040; 10739244; 11493008; 12885234; 1304349; 15152000; 15658854; 17642517; 17901324; 17955562; 19520086; 20156458; 22907907; 23290007; 24113284; 24175584; 26005532; 7574675; 7966150; 8367461; 8605148; 8637015; 9033393; 9108691; 9217260; 9232642; 9559654; 9578548; 9724521;
Motif
Gene Encoded By
Mass 6,970
Kinetics
Metal Binding
Rhea ID
Cross Reference Brenda