| IED ID | IndEnz0002015419 |
| Enzyme Type ID | protease015419 |
| Protein Name |
Kunitz trypsin inhibitor 2 AtKTI2 Cysteine protease inhibitor WSCP Kunitz-type cysteine protease inhibitor WSCP Water-soluble chlorophyll protein AtWSCP |
| Gene Name | KTI2 WSCP At1g72290 T9N14.19 |
| Organism | Arabidopsis thaliana (Mouse-ear cress) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) |
| Enzyme Sequence | MKNPSVISFLIILLFAATICTHGNEPVKDTAGNPLNTREQYFIQPVKTESKNGGGLVPAAITVLPFCPLGITQTLLPYQPGLPVSFVLALGVGSTVMTSSAVNIEFKSNIWPFCKEFSKFWEVDDSSSAPKEPSILIGGKMGDRNSSFKIEKAGEGARANVYKLTTFYGTVGAIPGVWLSAPQLIITKDTAKTLLVKFKKVDDATTATSNLYFPG |
| Enzyme Length | 215 |
| Uniprot Accession Number | Q9C7S6 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Water-soluble and chlorophyll-binding protein that probably does not function as a chloroplast chlorophyll carrier and is not involved in photosynthesis (PubMed:11577184, PubMed:26160583). Involved in the control of cell death in the transmitting tract and septum epidermis during flower development. Binds and inhibits the activity of the cysteine protease RD21A as a pro-death protein (PubMed:26160583). May play a role in herbivore resistance activation during seedling greening (PubMed:26016527). {ECO:0000269|PubMed:11577184, ECO:0000269|PubMed:26016527, ECO:0000269|PubMed:26160583}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (1); Glycosylation (1); Signal peptide (1) |
| Keywords | Apoplast;Cell wall;Disulfide bond;Endoplasmic reticulum;Glycoprotein;Plant defense;Protease inhibitor;Reference proteome;Secreted;Signal;Thiol protease inhibitor |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted, cell wall {ECO:0000269|PubMed:26016527, ECO:0000269|PubMed:26160583}. Secreted, extracellular space, apoplast {ECO:0000269|PubMed:26016527, ECO:0000269|PubMed:26160583}. Endoplasmic reticulum {ECO:0000269|PubMed:26289422}. Note=Targeted to ER bodies. {ECO:0000269|PubMed:26289422}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..23; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 12805595; 15894741; 15908604; 17028152; 17640338; 18426585; 22350767; 27625656; 28179567; |
| Motif | |
| Gene Encoded By | |
| Mass | 23,096 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |